KEGG   Homo sapiens (human): 5726Help
Entry
5726              CDS       T01001                                 

Gene name
TAS2R38, PTC, T2R38, T2R61, THIOT
Definition
(RefSeq) taste 2 receptor member 38
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04742 Taste transduction
    5726 (TAS2R38)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste type 2
    5726 (TAS2R38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TAS2R
Motif
Other DBs
NCBI-GeneID: 5726
NCBI-ProteinID: NP_789787
OMIM: 607751
HGNC: 9584
Ensembl: ENSG00000257138
Vega: OTTHUMG00000158374
Pharos: P59533(Tbio)
UniProt: P59533
Position
7q34
AA seq 333 aa AA seqDB search
MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDVVKRQALSNSDCVLLCL
SISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSK
LIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFFSRPHFTVTTVLFMNNNT
RLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRNSRDPSLE
AHIKALKSLVSFFCFFVISSCVAFISVPLLILWRDKIGVMVCVGIMAACPSGHAAILISG
NAKLRRAVMTILLWAQSSLKVRADHKADSRTLC
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgttgactctaactcgcatccgcactgtgtcctatgaagtcaggagtacatttctgttc
atttcagtcctggagtttgcagtggggtttctgaccaatgccttcgttttcttggtgaat
ttttgggatgtagtgaagaggcaggcactgagcaacagtgattgtgtgctgctgtgtctc
agcatcagccggcttttcctgcatggactgctgttcctgagtgctatccagcttacccac
ttccagaagttgagtgaaccactgaaccacagctaccaagccatcatcatgctatggatg
attgcaaaccaagccaacctctggcttgctgcctgcctcagcctgctttactgctccaag
ctcatccgtttctctcacaccttcctgatctgcttggcaagctgggtctccaggaagatc
tcccagatgctcctgggtattattctttgctcctgcatctgcactgtcctctgtgtttgg
tgcttttttagcagacctcacttcacagtcacaactgtgctattcatgaataacaataca
aggctcaactggcagattaaagatctcaatttattttattcctttctcttctgctatctg
tggtctgtgcctcctttcctattgtttctggtttcttctgggatgctgactgtctccctg
ggaaggcacatgaggacaatgaaggtctataccagaaactctcgtgaccccagcctggag
gcccacattaaagccctcaagtctcttgtctcctttttctgcttctttgtgatatcatcc
tgtgttgccttcatctctgtgcccctactgattctgtggcgcgacaaaataggggtgatg
gtttgtgttgggataatggcagcttgtccctctgggcatgcagccatcctgatctcaggc
aatgccaagttgaggagagctgtgatgaccattctgctctgggctcagagcagcctgaag
gtaagagccgaccacaaggcagattcccggacactgtgctga

DBGET integrated database retrieval system