KEGG   Homo sapiens (human): 57292Help
Entry
57292             CDS       T01001                                 

Gene name
KIR2DL5A, CD158F, KIR2DL5, KIR2DL5.1, KIR2DL5.3
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 5A
  KO
K07981  killer cell immunoglobulin-like receptor 2DL
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    57292 (KIR2DL5A)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    57292 (KIR2DL5A)
   04612 Antigen processing and presentation
    57292 (KIR2DL5A)
 09160 Human Diseases
  09162 Immune diseases
   05332 Graft-versus-host disease
    57292 (KIR2DL5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:hsa04090]
    57292 (KIR2DL5A)
CD molecules [BR:hsa04090]
 Proteins
  57292 (KIR2DL5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig Ig_2 Ig_3 V-set Shisa SIT WBP-1 Tweety
Motif
Other DBs
NCBI-GeneID: 57292
NCBI-ProteinID: NP_065396
OMIM: 605305
HGNC: 16345
Pharos: Q8N109(Tdark)
UniProt: Q8N109 A0A191URI1
Position
19p13.3
AA seq 375 aa AA seqDB search
MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSL
YKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGL
FGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADF
PLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLH
ILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQ
LDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTAL
SQNRVASSHVPAAGI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcatggtcatcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
acacatgagggtggtcaggacaagcccttgctgtctgcctggcccagcgctgtggtgcct
cgaggaggacatgtgactcttctgtgtcgctctcgtcttgggtttaccatcttcagtctg
tacaaagaagatggggtgcctgtccctgagctctacaacaaaatattctggaagagcatc
ctcatgggccctgtgacccctgcacacgcagggacctacagatgtcggggttcacaccca
cgctcccccattgagtggtcagcacccagcaaccccctggtgatcgtggtcacaggtcta
tttgggaaaccttcactctcagcccagccgggccccacggttcgcacaggagagaacgtg
accttgtcctgcagctccaggagctcatttgacatgtaccatctatccagggaggggagg
gcccatgaacctaggctccctgcagtgcccagcgtcaatggaacattccaggctgacttt
cctctgggccctgccacccacggagggacctacacatgcttcggctctctccatgactca
ccctatgagtggtcagacccgagtgacccactgcttgtttctgtcacaggaaactcttca
agtagttcatcttcacccactgaaccaagctccaaaactggtatccgcagacacctgcac
attctgattgggacctcagtggctatcatcctcttcatcatcctcttcttctttctcctt
cattgctgctgctccaacaaaaagaatgctgctgtaatggaccaagagcctgccggggac
agaacagtgaacagggaggactctgatgatcaagaccctcaggaggtgacatatgcacag
ttggatcactgcgttttcacacagacaaaaatcacttccccttctcagaggcccaagaca
cctccaacagataccaccatgtacatggaacttccaaatgctaagccaagatcattgtct
cctgcccataagcaccacagtcaggccttgaggggatcttctagggagacaacagccctg
tctcaaaaccgggttgctagctcccatgtaccagcagctggaatctga

DBGET integrated database retrieval system