KEGG   Homo sapiens (human): 573Help
Entry
573               CDS       T01001                                 

Gene name
BAG1, BAG-1, HAP, RAP46
Definition
(RefSeq) BCL2 associated athanogene 1
  KO
K09555  BCL2-associated athanogene 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    573 (BAG1)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  BAG
   573 (BAG1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Co-chaperones
    573 (BAG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin BAG DUF5082 Rad60-SLD
Motif
Other DBs
NCBI-GeneID: 573
NCBI-ProteinID: NP_004314
OMIM: 601497
HGNC: 937
Ensembl: ENSG00000107262
Vega: OTTHUMG00000019766
Pharos: Q99933(Tbio)
UniProt: Q99933
Structure
PDB: 

Position
9p13.3
AA seq 345 aa AA seqDB search
MAQRGGARRPRGDRERLGSRLRALRPGREPRQSEPPAQRGPPPSRRPPARSTASGHDRPT
RGAAAGARRPRMKKKTRRRSTRSEELTRSEELTLSEEATWSEEATQSEEATQGEEMNRSQ
EVTRDEESTRSEEVTREEMAAAGLTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQVVEEV
IGVPQSFQKLIFKGKSLKEMETPLSALGIQDGCRVMLIGKKNSPQEEVELKKLKHLEKSV
EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPEN
FKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ctggctcagcgcgggggggcgcggagaccgcgaggcgaccgggagcggctgggttcccgg
ctgcgcgcccttcggccaggccgggagccgcgccagtcggagcccccggcccagcgtggt
ccgcctccctctcggcgtccacctgcccggagtactgccagcgggcatgaccgacccacc
aggggcgccgccgccggcgctcgcaggccgcggatgaagaagaaaacccggcgccgctcg
acccggagcgaggagttgacccggagcgaggagttgaccctgagtgaggaagcgacctgg
agtgaagaggcgacccagagtgaggaggcgacccagggcgaagagatgaatcggagccag
gaggtgacccgggacgaggagtcgacccggagcgaggaggtgaccagggaggaaatggcg
gcagctgggctcaccgtgactgtcacccacagcaatgagaagcacgaccttcatgttacc
tcccagcagggcagcagtgaaccagttgtccaagacctggcccaggttgttgaagaggtc
ataggggttccacagtcttttcagaaactcatatttaagggaaaatctctgaaggaaatg
gaaacaccgttgtcagcacttggaatacaagatggttgccgggtcatgttaattgggaaa
aagaacagtccacaggaagaggttgaactaaagaagttgaaacatttggagaagtctgtg
gagaagatagctgaccagctggaagagttgaataaagagcttactggaatccagcagggt
tttctgcccaaggatttgcaagctgaagctctctgcaaacttgataggagagtaaaagcc
acaatagagcagtttatgaagatcttggaggagattgacacactgatcctgccagaaaat
ttcaaagacagtagattgaaaaggaaaggcttggtaaaaaaggttcaggcattcctagcc
gagtgtgacacagtggagcagaacatctgccaggagactgagcggctgcagtctacaaac
tttgccctggccgagtga

DBGET integrated database retrieval system