KEGG   Homo sapiens (human): 5730Help
Entry
5730              CDS       T01001                                 

Gene name
PTGDS, L-PGDS, LPGDS, PDS, PGD2, PGDS, PGDS2
Definition
(RefSeq) prostaglandin D2 synthase
  KO
K01830  prostaglandin-H2 D-isomerase [EC:5.3.99.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    5730 (PTGDS)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.2  prostaglandin-D synthase
     5730 (PTGDS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin Triabin VDE
Motif
Other DBs
NCBI-GeneID: 5730
NCBI-ProteinID: NP_000945
OMIM: 176803
HGNC: 9592
Ensembl: ENSG00000107317
Vega: OTTHUMG00000020957
Pharos: P41222(Tbio)
UniProt: P41222 A0A024R8G3
Structure
PDB: 

Position
9q34.3
AA seq 190 aa AA seqDB search
MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKA
ALSMCKSVVAPATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSV
VETDYDQYALLYSQGSKGPGEDFRMATLYSRTQTPRAELKEKFTAFCKAQGFTEDTIVFL
PQTDKCMTEQ
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggctactcatcacacactgtggatgggactggccctgctgggggtgctgggcgacctg
caggcagcaccggaggcccaggtctccgtgcagcccaacttccagcaggacaagttcctg
gggcgctggttcagcgcgggcctcgcctccaactcgagctggctccgggagaagaaggcg
gcgttgtccatgtgcaagtctgtggtggcccctgccacggatggtggcctcaacctgacc
tccaccttcctcaggaaaaaccagtgtgagacccgaaccatgctgctgcagcccgcgggg
tccctcggctcctacagctaccggagtccccactggggcagcacctactccgtgtcagtg
gtggagaccgactacgaccagtacgcgctgctgtacagccagggcagcaagggccctggc
gaggacttccgcatggccaccctctacagccgaacccagacccccagggctgagttaaag
gagaaattcaccgccttctgcaaggcccagggcttcacagaggataccattgtcttcctg
ccccaaaccgataagtgcatgacggaacaatag

DBGET integrated database retrieval system