KEGG   Homo sapiens (human): 5731Help
Entry
5731              CDS       T01001                                 

Gene name
PTGER1, EP1
Definition
(RefSeq) prostaglandin E receptor 1
  KO
K04258  prostaglandin E receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Drug target
Alprostadil (DG00239): D00180 D02705
Ecraprost: D02723
Enisoprost: D03999
Gemeprost: D02073
Limaprost (DG01271): D02722 D02860
Ornoprostil: D01869
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5731 (PTGER1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5731 (PTGER1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5731 (PTGER1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    5731 (PTGER1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5731 (PTGER1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    5731 (PTGER1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 5731
NCBI-ProteinID: NP_000946
OMIM: 176802
HGNC: 9593
Ensembl: ENSG00000160951
Vega: OTTHUMG00000039610
Pharos: P34995(Tclin)
UniProt: P34995
Position
19p13.12
AA seq 402 aa AA seqDB search
MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQA
AGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFF
GLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYE
LQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRR
PPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV
GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLR
QLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagcccttgcgggcccctcaacctgagcctggcgggcgaggcgaccacatgcgcggcg
ccctgggtccccaacacgtcggccgtgccgccgtcgggcgcttcgcccgcgctgcccatc
ttctccatgacgctgggcgccgtgtccaacctgctggcgctggcgctgctggcgcaggcc
gcgggccgcctgcgacgccgccgctcggccgccaccttcctgctgttcgtggccagcctg
ctggccaccgacctggcgggccacgtgatcccgggcgcgctggtgctgcgtctgtacact
gcggggcgcgctccggccggcggggcctgccacttcctgggcggctgcatggtcttcttc
ggcctgtgcccgctgctgctgggctgtggcatggccgtggagcgctgcgtgggcgtcacg
cggccgctgctccacgccgcgcgggtctcggtcgcccgcgcgcgcctggcgctggccgcg
gtggccgcggtggccttggccgtggcgctgctgccgctggcgcgcgtgggccgctatgag
ctgcagtacccgggcacgtggtgcttcatcggcctgggtcccccgggcggctggcgccag
gcactgcttgctggcctcttcgccagcctcggcctggtcgcgctcctcgccgcgctggtg
tgcaacacgctcagcggcctggccctgctacgcgcccgctggcgacgccgctcccgacgg
cctcccccggcctcaggccccgacagccggcgtcgctggggggcgcacggaccccgctcg
gcctccgcctcgtccgcctcgtccatcgcttcggcctccaccttctttggcggctctcgg
agcagcggctcggcacgcagagctcgcgcccacgacgtggagatggtgggccagcttgtc
ggtatcatggtggtgtcgtgcatctgctggagcccaatgctggtgttggtggcgctggcc
gtcggcggctggagctctacctccctgcagcggccactgttcctggccgtgcgccttgcc
tcctggaaccagatcctggacccttgggtgtacatcctactgcgccaggccgtgctgcgc
caactgcttcgcctcttgcccccgagggccggagccaagggcggccccgcggggctgggc
ctaacaccgagcgcctgggaggccagctcgctgcgcagctcccggcacagcggcctcagc
cacttctaa

DBGET integrated database retrieval system