KEGG   Homo sapiens (human): 5732Help
Entry
5732              CDS       T01001                                 

Gene name
PTGER2, EP2
Definition
(RefSeq) prostaglandin E receptor 2
  KO
K04259  prostaglandin E receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04924  Renin secretion
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Drug target
Arbaprostil: D02975
Butaprost: D03187
Dinoprostone (DG00448): D00079 D03269
Enprostil: D01891
Evatanepag (DG01894): D09613 D09614
Meteneprost: D02726
Misoprostol: D00419
Omidenepag (DG02831): D10965 D10966
Rioprostil: D05732
Sulprostone: D02725
Taprenepag (DG01895): D09968 D09969
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5732 (PTGER2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5732 (PTGER2)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    5732 (PTGER2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5732 (PTGER2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    5732 (PTGER2)
  09167 Infectious diseases
   05163 Human cytomegalovirus infection
    5732 (PTGER2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5732 (PTGER2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Prostaglandin
    5732 (PTGER2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx Srg DUF412
Motif
Other DBs
NCBI-GeneID: 5732
NCBI-ProteinID: NP_000947
OMIM: 176804
HGNC: 9594
Ensembl: ENSG00000125384
Vega: OTTHUMG00000140300
Pharos: P43116(Tclin)
UniProt: P43116
Position
14q22.1
AA seq 358 aa AA seqDB search
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatgcctccaatgactcccagtctgaggactgcgagacgcgacagtggcttccc
ccaggcgaaagcccagccatcagctccgtcatgttctcggccggggtgctggggaacctc
atagcactggcgctgctggcgcgccgctggcggggggacgtggggtgcagcgccggccgc
aggagctccctctccttgttccacgtgctggtgaccgagctggtgttcaccgacctgctc
gggacctgcctcatcagcccagtggtactggcttcgtacgcgcggaaccagaccctggtg
gcactggcgcccgagagccgcgcgtgcacctacttcgctttcgccatgaccttcttcagc
ctggccacgatgctcatgctcttcgccatggccctggagcgctacctctcgatcgggcac
ccctacttctaccagcgccgcgtctcgcgctccgggggcctggccgtgctgcctgtcatc
tatgcagtctccctgctcttctgctcgctgccgctgctggactatgggcagtacgtccag
tactgccccgggacctggtgcttcatccggcacgggcggaccgcttacctgcagctgtac
gccaccctgctgctgcttctcattgtctcggtgctcgcctgcaacttcagtgtcattctc
aacctcatccgcatgcaccgccgaagccggagaagccgctgcggaccttccctgggcagt
ggccggggcggccccggggcccgcaggagaggggaaagggtgtccatggcggaggagacg
gaccacctcattctcctggctatcatgaccatcaccttcgccgtctgctccttgcctttc
acgatttttgcatatatgaatgaaacctcttcccgaaaggaaaaatgggacctccaagct
cttaggtttttatcaattaattcaataattgacccttgggtctttgccatccttaggcct
cctgttctgagactaatgcgttcagtcctctgttgtcggatttcattaagaacacaagat
gcaacacaaacttcctgttctacacagtcagatgccagtaaacaggctgacctttga

DBGET integrated database retrieval system