KEGG   Homo sapiens (human): 57325
Entry
57325             CDS       T01001                                 

Gene name
KAT14, ATAC2, CRP2BP, CSRP2BP, PRO1194, dJ717M23.1
Definition
(RefSeq) lysine acetyltransferase 14
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47 Acetyltransf_9 GNAT_acetyltran Acetyltransf_13 zf_UBZ
Other DBs
NCBI-GeneID: 57325
NCBI-ProteinID: NP_065397
OMIM: 617501
HGNC: 15904
Ensembl: ENSG00000149474
Vega: OTTHUMG00000031962
Pharos: Q9H8E8(Tbio)
UniProt: Q9H8E8
Position
20p11.23
AA seq 782 aa
MDSSIHLSSLISRHDDEATRTSTSEGLEEGEVEGETLLIVESEDQASVDLSHDQSGDSLN
SDEGDVSWMEEQLSYFCDKCQKWIPASQLREQLSYLKGDNFFRFTCSDCSADGKEQYERL
KLTWQQVVMLAMYNLSLEGSGRQGYFRWKEDICAFIEKHWTFLLGNRKKTSTWWSTVAGC
LSVGSPMYFRSGAQEFGEPGWWKLVHNKPPTMKPEGEKLSASTLKIKAASKPTLDPIITV
EGLRKRASRNPVESAMELKEKRSRTQEAKDIRRAQKEAAGFLDRSTSSTPVKFISRGRRP
DVILEKGEVIDFSSLSSSDRTPLTSPSPSPSLDFSAPGTPASHSATPSLLSEADLIPDVM
PPQALFHDDDEMEGDGVIDPGMEYVPPPAGSVASGPVVGGRKKVRGPEQIKQEVESEEEK
PDRMDIDSEDTDSNTSLQTRAREKRKPQLEKDTKPKEPRYTPVSIYEEKLLLKRLEACPG
AVAMTPEARRLKRKLIVRQAKRDRGLPLFDLDQVVNAALLLVDGIYGAKEGGISRLPAGQ
ATYRTTCQDFRILDRYQTSLPSRKGFRHQTTKFLYRLVGSEDMAVDQSIVSPYTSRILKP
YIRRDYETKPPKLQLLSQIRSHLHRSDPHWTPEPDAPLDYCYVRPNHIPTINSMCQEFFW
PGIDLSECLQYPDFSVVVLYKKVIIAFGFMVPDVKYNEAYISFLFVHPEWRRAGIATFMI
YHLIQTCMGKDVTLHVSASNPAMLLYQKFGFKTEEYVLDFYDKYYPLESTECKHAFFLRL
RR
NT seq 2349 nt   +upstreamnt  +downstreamnt
atggatagtagcatccacctgagtagtctgatcagtcggcatgatgacgaagccacgaga
acatcgacctcagaaggactggaggaaggtgaagtggagggagagacgctcctgatcgtc
gaatccgaggatcaggcatcagtggacttatcgcacgaccagagtggggattccctcaac
agtgatgaaggagacgtgtcttggatggaggagcagctgtcctacttctgtgacaagtgc
caaaaatggataccagccagtcagctgagggaacagctcagttaccttaagggtgataat
ttttttaggtttacttgttcggattgctcagcagatggcaaggagcagtatgaaaggctg
aagctgacatggcagcaagtcgtcatgttggcaatgtacaacttgtctctggaaggaagt
ggacgtcaaggttatttcaggtggaaagaagatatctgtgcttttattgagaaacattgg
acttttttactagggaataggaaaaagacgtctacctggtggagcaccgtggcaggttgc
ctcagcgtgggaagtcccatgtacttccgttcaggtgctcaggaatttggagagccagga
tggtggaaacttgttcataacaagcccccaacgatgaaacctgaaggagagaagttgtct
gcctctactttgaaaataaaagcagcctcaaaaccaactttagatcccatcattactgtt
gagggacttagaaaacgagcaagtcggaatcctgtggaatctgccatggaattaaaagag
aaaaggtctcgaactcaggaagcaaaagacattagaagagcccagaaggaggccgctggc
tttcttgacaggagcacatcttctacccctgtaaaattcataagccgaggccgcaggcca
gatgtgattctggaaaaaggcgaagtgattgacttttcctccttgagctcctctgaccgc
accccgctgacaagcccatctccttctccttctctggatttctctgcccctggtacacct
gcctctcattctgccacacctagcttgctttcagaagcagatctgattccagatgtgatg
cccccacaagccttgtttcatgatgacgatgagatggaaggcgatggagtcatagaccca
gggatggagtacgtcccaccccctgctgggtcagtagcttctgggccagtggttgggggc
agaaagaaggtcagaggccctgaacagataaagcaggaggtagagagtgaggaggaaaaa
cccgacaggatggatattgacagtgaagacacagattcaaacacatctttgcaaacaagg
gctagagaaaagaggaagcctcagctggagaaggacacaaagccgaaagagcccaggtat
actcccgtgagcatctacgaggaaaagctgctgctcaagaggctggaagcttgtcccggt
gctgttgccatgactccggaagctcggagactgaaacgcaaactgattgtcagacaagcg
aaaagggataggggattaccactttttgacttggatcaagttgttaatgctgctcttttg
ttagttgacgggatttatggagccaaagaaggaggaatttccagacttccagctggacaa
gccacgtacagaaccacctgtcaggacttcagaatccttgaccgataccagacttccttg
ccgtccaggaagggatttcgacaccagaccaccaagtttttgtatcgcttggtaggatca
gaagatatggctgtggaccagagtattgtcagcccttatacctctcggatcttgaaacct
tatatcaggcgtgattatgaaacaaagccacccaaactgcagctcctgtcacagattcgt
tcccacctgcacaggagcgaccctcactggacgccggagcccgacgcacctctcgattac
tgttatgtgcggccaaatcacatcccaacgatcaactccatgtgtcaggagtttttttgg
cctggcattgacctgtctgagtgtctgcagtacccagacttcagtgttgttgttctttat
aaaaaagtcatcattgcctttggcttcatggttcctgatgtgaaatacaatgaagcttac
atttcatttctgttcgtccaccctgaatggagaagagcagggattgcaactttcatgatc
tatcatctgattcagacctgcatgggcaaggacgtaacccttcacgtctcagcaagcaac
cccgctatgctactgtaccagaagtttggattcaagactgaagaatatgtattagatttc
tatgataaatattacccattggagagtacagagtgtaaacacgcattctttctgaggctc
cggcgctga

DBGET integrated database retrieval system