KEGG   Homo sapiens (human): 5733Help
Entry
5733              CDS       T01001                                 

Gene name
PTGER3, EP3, EP3-I, EP3-II, EP3-III, EP3-IV, EP3-VI, EP3e, PGE2-R
Definition
(RefSeq) prostaglandin E receptor 3
  KO
K04260  prostaglandin E receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04923  Regulation of lipolysis in adipocytes
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Drug target
Enprostil: D01891
Misoprostol: D00419
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5733 (PTGER3)
   04024 cAMP signaling pathway
    5733 (PTGER3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5733 (PTGER3)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    5733 (PTGER3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5733 (PTGER3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    5733 (PTGER3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5733 (PTGER3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    5733 (PTGER3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srbc
Motif
Other DBs
NCBI-GeneID: 5733
NCBI-ProteinID: NP_001119516
OMIM: 176806
HGNC: 9595
Ensembl: ENSG00000050628
Vega: OTTHUMG00000009399
Pharos: P43115(Tclin)
UniProt: P43115
Position
1p31.1
AA seq 390 aa AA seqDB search
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagacccggggctacggaggggatgcccccttctgcacccgcctcaaccactcc
tacacaggcatgtgggcgcccgagcgttccgccgaggcgcggggcaacctcacgcgccct
ccagggtctggcgaggattgcggatcggtgtccgtggccttcccgatcaccatgctgctc
actggtttcgtgggcaacgcactggccatgctgctcgtgtcgcgcagctaccggcgccgg
gagagcaagcgcaagaagtccttcctgctgtgcatcggctggctggcgctcaccgacctg
gtcgggcagcttctcaccaccccggtcgtcatcgtcgtgtacctgtccaagcagcgttgg
gagcacatcgacccgtcggggcggctctgcacctttttcgggctgaccatgactgttttc
gggctctcctcgttgttcatcgccagcgccatggccgtcgagcgggcgctggccatcagg
gcgccgcactggtatgcgagccacatgaagacgcgtgccacccgcgctgtgctgctcggc
gtgtggctggccgtgctcgccttcgccctgctgccggtgctgggcgtgggccagtacacc
gtccagtggcccgggacgtggtgcttcatcagcaccgggcgagggggcaacgggactagc
tcttcgcataactggggcaaccttttcttcgcctctgcctttgccttcctggggctcttg
gcgctgacagtcaccttttcctgcaacctggccaccattaaggccctggtgtcccgctgc
cgggccaaggccacggcatctcagtccagtgcccagtggggccgcatcacgaccgagacg
gccattcagcttatggggatcatgtgcgtgctgtcggtctgctggtctccgctcctgata
atgatgttgaaaatgatcttcaatcagacatcagttgagcactgcaagacacacacggag
aagcagaaagaatgcaacttcttcttaatagctgttcgcctggcttcactgaaccagatc
ttggatccttgggtttacctgctgttaagaaagatccttcttcgaaagttttgccagatc
aggtaccacacaaacaactatgcatccagctccacctccttaccctgccagtgttcctca
accttgatgtggagcgaccatttggaaagatga

DBGET integrated database retrieval system