KEGG   Homo sapiens (human): 57332Help
Entry
57332             CDS       T01001                                 

Gene name
CBX8, PC3, RC1
Definition
(RefSeq) chromobox 8
  KO
K11455  chromobox protein 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    57332 (CBX8)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     57332 (CBX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chromo CBX7_C Atrophin-1 RBR Mtf2_C Tudor-knot VirC1
Motif
Other DBs
NCBI-GeneID: 57332
NCBI-ProteinID: NP_065700
OMIM: 617354
HGNC: 15962
Ensembl: ENSG00000141570
Vega: OTTHUMG00000150416
Pharos: Q9HC52(Tchem)
UniProt: Q9HC52
Structure
PDB: 

Position
17q25.3
AA seq 389 aa AA seqDB search
MELSAVGERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEER
EREMELYGPKKRGPKPKTFLLKAQAKAKAKTYEFRSDSARGIRIPYPGRSPQDLASTSRA
REGLRNMGLSPPASSTSTSSTCRAEAPRDRDRDRDRDRERDRERERERERERERERERER
GTSRVDDKPSSPGDSSKKRGPKPRKELPDPSQRPLGEPSAGLGEYLKGRKLDDTPSGAGK
FPAGHSVIQLARRQDSDLVQCGVTSPSSAEATGKLAVDTFPARVIKHRAAFLEAKGQGAL
DPNGTRVRHGSGPPSSGGGLYRDMGAQGGRPSLIARIPVARILGDPEEESWSPSLTNLEK
VVVTDVTSNFLTVTIKESNTDQGFFKEKR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggagctttcagcggtgggggagcgggtgttcgcggccgaagccctcctgaagcggcgc
atacggaaaggacgcatggaatacctcgtgaaatggaagggatggtcgcagaagtacagc
acatgggaaccggaggaaaacatcctggatgctcgcttgctcgcagcctttgaggaaagg
gaaagagagatggagctctatggccccaaaaagcgtggacccaagcccaaaaccttcctc
ctcaaagcgcaggccaaggcaaaggccaaaacttacgagtttcgaagtgactcagccagg
ggcatccggatcccctaccctggccgctcgccccaggacctggcctccacttcccgggcc
cgggagggccttcgaaacatgggtttgtccccgccagcgagcagcaccagcaccagcagc
acctgccgcgcagaggcccctcgggaccgggaccgagaccgggatagggaccgggagcgg
gatcgagaaagggagagggagcgagagagggagcgggaacgtgagagggaacgagagcgg
ggtaccagcagagtggatgacaagcccagctcaccgggggacagctcgaagaagcgaggc
cccaagccccggaaggagctcccggacccctcacagaggcccttaggcgaacccagcgcc
ggcctcggagagtacctcaagggcaggaagctggacgacaccccttccggggcaggaaag
tttccagccggccacagtgtgatccagctggcccgaagacaggactcggacctggtgcag
tgtggtgtgaccagccctagctcagctgaggccacgggcaaactggctgtggacaccttc
ccggccagggtgataaagcacagggctgccttcctggaggccaaaggccagggtgcccta
gatcccaatggcacccgggtccgacatggctcaggcccccccagctctggggggggcctg
taccgggacatgggggcccaggggggaaggccctccctcatcgccaggatccctgtggcc
agaatcctgggggacccggaggaagagtcctggagcccctccctgactaacctggagaag
gtggtggtcacggacgtgacctcaaactttttgaccgtcaccattaaggaaagtaacacg
gaccaaggcttttttaaagagaaaagatga

DBGET integrated database retrieval system