KEGG   Homo sapiens (human): 57343Help
Entry
57343             CDS       T01001                                 

Gene name
ZNF304
Definition
(RefSeq) zinc finger protein 304
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    57343 (ZNF304)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    57343 (ZNF304)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    57343 (ZNF304)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB Zn-ribbon_8 zf-C2H2_jaz zf_UBZ zinc_ribbon_15 zf-C2H2_6
Motif
Other DBs
NCBI-GeneID: 57343
NCBI-ProteinID: NP_065708
OMIM: 613840
HGNC: 13505
Ensembl: ENSG00000131845
Vega: OTTHUMG00000183245
Pharos: Q9HCX3(Tdark)
UniProt: Q9HCX3 Q2T9G7
Position
19q13.43
AA seq 659 aa AA seqDB search
MAAAVLMDRVQSCVTFEDVFVYFSREEWELLEEAQRFLYRDVMLENFALVATLGFWCEAE
HEAPSEQSVSVEGVSQVRTAESGLFQKAHPCEMCDPLLKDILHLAEHQGSHLTQKLCTRG
LCRRRFSFSANFYQHQKQHNGENCFRGDDGGASFVKSCTVHMLGRSFTCREEGMDLPDSS
GLFQHQTTYNRVSPCRRTECMESFPHSSSLRQHQGDYDGQMLFSCGDEGKAFLDTFTLLD
SQMTHAEVRPFRCLPCGNVFKEKSALINHRKIHSGEISHVCKECGKAFIHLHHLKMHQKF
HTGKRHYTCSECGKAFSRKDTLVQHQRVHTGERSYDCSECGKAYSRSSHLVQHQRIHTGE
RPYKCNKCGKAFSRKDTLVQHQRFHTGERPYECSECGKFFSQSSHLIEHWRIHTGARPYE
CIECGKFFSHNSSLIKHRRVHTGARSYVCSKCGKAFGCKDTLVQHQIIHTGARPYECSEC
GKAFSRKDTLVQHQKIHTGERPYECGECGKFFSHSSNLIVHQRIHTGAKPYECNECGKCF
SHNSSLILHQRVHTGARPYVCSECGKAYISSSHLVQHKKVHTGARPYECSECGKFFSRNS
GLILHQRVHTGEKPYVCSECGKAYSRSSHLVRHQKAHTGERAHECNSFGGPLAASLKLV
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcggtgctgatggaccgggttcagagttgtgtgaccttcgaggatgtgttc
gtgtacttctctcgggaggagtgggaactccttgaggaggcacagagattcctgtaccgt
gatgtgatgctggagaactttgcacttgtggctacactaggtttttggtgtgaagcagaa
catgaggcaccttctgagcagagcgtttctgtagaaggagtgtcacaggtcaggactgct
gagtcaggtcttttccagaaagcacacccatgtgagatgtgtgacccactcttgaaagac
attttgcacctggctgaacaccagggatcacaccttacacagaaactgtgcacacgtggg
ctgtgtaggagaagattctcgttcagtgcaaacttttaccagcaccagaagcaacataat
ggagagaattgcttcagaggggatgatggaggggcctcatttgtgaagagctgtacagtc
cacatgttagggagatcctttacgtgcagggaggaagggatggacttaccagatagctct
ggccttttccagcaccagaccacttacaatagggtgagtccatgcagaaggactgaatgc
atggagtctttcccacacagctccagtctcaggcaacaccaaggagactatgatggacag
atgcttttcagttgcggtgatgaagggaaagccttcctggacacctttactcttcttgac
agccagatgactcatgctgaggtgagacccttcagatgcctaccatgtggaaatgtgttc
aaggagaaatcagctcttattaatcacagaaaaatccacagtggagaaatatctcatgtg
tgtaaggagtgtggaaaagccttcattcacttgcaccacctaaaaatgcaccagaaattt
cacactggaaaaagacactatacatgcagtgaatgtgggaaggccttcagccgcaaggac
acacttgttcagcatcagagagttcacactggagaaagatcttatgactgcagtgaatgt
ggaaaagcctacagcagaagctcccaccttgttcagcaccagagaattcacacaggagaa
aggccttataagtgcaacaaatgtgggaaagcctttagccgtaaagacacacttgttcag
caccagagatttcatactggagaaaggccttatgagtgcagtgaatgtggaaaattcttt
agccaaagctcccaccttattgagcactggagaattcataccggggcaaggccctatgaa
tgcatagaatgtggaaaattctttagccataactctagcctcattaaacatcggagagtc
cacacaggagcaagatcctacgtgtgcagcaaatgtgggaaggcctttggctgcaaagac
acacttgttcagcaccagataattcacactggagcaaggccttatgagtgcagtgaatgt
gggaaggccttcagccgtaaagacacacttgtgcaacaccaaaaaatccacactggagaa
aggccttatgagtgtggtgaatgtggtaaattcttcagccatagctccaaccttattgta
caccagagaattcacactggagcaaagccttatgagtgcaatgaatgtgggaaatgcttt
agccacaactccagcctcattttgcaccagagagttcacacaggagcaaggccttatgtg
tgcagtgaatgtgggaaggcttacattagtagctcccaccttgttcaacacaagaaagtt
cacactggagcaagaccttatgagtgcagtgaatgtgggaaattctttagccgcaactct
ggcctcattctgcaccagagggttcacactggagaaaagccttacgtatgcagcgaatgt
gggaaagcctatagcagaagctcccatcttgttcgtcaccagaaagctcacactggagaa
agagctcacgagtgcaacagttttggtggccctttagctgcatctcttaaacttgtttaa

DBGET integrated database retrieval system