KEGG   Homo sapiens (human): 57381Help
Entry
57381             CDS       T01001                                 

Gene name
RHOJ, ARHJ, RASL7B, TC10B, TCL
Definition
(RefSeq) ras homolog family member J
  KO
K07864  Ras homolog gene family, member J
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    57381 (RHOJ)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    57381 (RHOJ)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    57381 (RHOJ)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    57381 (RHOJ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf TniB
Motif
Other DBs
NCBI-GeneID: 57381
NCBI-ProteinID: NP_065714
OMIM: 607653
HGNC: 688
Ensembl: ENSG00000126785
Vega: OTTHUMG00000140342
Pharos: Q9H4E5(Tbio)
UniProt: Q9H4E5 A0A024R692 Q7Z513
Position
14q23.2
AA seq 214 aa AA seqDB search
MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAV
TVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK
DCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQ
KGLKAVFDEAILTIFHPKKKKKRCSEGHSCCSII
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaactgcaaagagggaactgacagcagctgcggctgcaggggcaacgacgagaagaag
atgttgaagtgtgtggtggtgggggacggtgccgtggggaaaacctgcctgctgatgagc
tacgccaacgacgccttcccagaggaatacgtgcccactgtgtttgaccactatgcagtt
actgtgactgtgggaggcaagcaacacttgctcggactgtatgacaccgcgggacaggag
gactacaaccagctgaggccactctcctaccccaacacggatgtgtttttgatctgcttc
tctgtcgtaaaccctgcctcttaccacaatgtccaggaggaatgggtccccgagctcaag
gactgcatgcctcacgtgccttatgtcctcatagggacccagattgatctccgtgatgac
ccaaaaaccttggcccgtttgctgtatatgaaagagaaacctctcacttacgagcatggt
gtgaagctcgcaaaagcgatcggagcacagtgctacttggaatgttcagctctgactcag
aaaggtctcaaagcggtttttgatgaagcaatcctcaccattttccaccccaagaaaaag
aagaaacgctgttctgagggtcacagctgctgttcaattatctga

DBGET integrated database retrieval system