KEGG   Homo sapiens (human): 5741
Entry
5741              CDS       T01001                                 
Symbol
PTH, FIH1, PTH1
Name
(RefSeq) parathyroid hormone
  KO
K05261  parathyroid hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05323  Rheumatoid arthritis
Network
nt06318  CaSR-PTH signaling
  Element
N00288  PTH-PTH1R-PKA signaling pathway
N00291  CaSR-PTH signaling pathway
N00293  GCM2-mediated transcription
Disease
H01862  Hypoparathyroidism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5741 (PTH)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    5741 (PTH)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    5741 (PTH)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    5741 (PTH)
SSDB
Motif
Pfam: Parathyroid ABC_ATPase
Other DBs
NCBI-GeneID: 5741
NCBI-ProteinID: NP_000306
OMIM: 168450
HGNC: 9606
Ensembl: ENSG00000152266
Pharos: P01270(Tbio)
CPD: C16051
UniProt: P01270
Structure
Position
11:complement(13492054..13496181)
AA seq 115 aa
MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQ
DVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
NT seq 348 nt   +upstreamnt  +downstreamnt
atgatacctgcaaaagacatggctaaagttatgattgtcatgttggcaatttgttttctt
acaaaatcggatgggaaatctgttaagaagagatctgtgagtgaaatacagcttatgcat
aacctgggaaaacatctgaactcgatggagagagtagaatggctgcgtaagaagctgcag
gatgtgcacaattttgttgcccttggagctcctctagctcccagagatgctggttcccag
aggccccgaaaaaaggaagacaatgtcttggttgagagccatgaaaaaagtcttggagag
gcagacaaagctgatgtgaatgtattaactaaagctaaatcccagtga

DBGET integrated database retrieval system