KEGG   Homo sapiens (human): 57419
Entry
57419             CDS       T01001                                 

Symbol
SLC24A3, NCKX3
Name
(RefSeq) solute carrier family 24 member 3
  KO
K13751  solute carrier family 24 (sodium/potassium/calcium exchanger), member 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    57419 (SLC24A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC24: Na+/(Ca2+-K+) exchanger
   57419 (SLC24A3)
SSDB
Motif
Pfam: Na_Ca_ex CENP-B_dimeris SPC25 NOA36 Ribosomal_60s PBP1_TM
Other DBs
NCBI-GeneID: 57419
NCBI-ProteinID: NP_065740
OMIM: 609839
HGNC: 10977
Ensembl: ENSG00000185052
Vega: OTTHUMG00000031993
Pharos: Q9HC58(Tbio)
UniProt: Q9HC58
Position
20p11.23
AA seq 644 aa
MRPSGDEDRARRRRRRRRRRDLLLSQLCFLASVALLLWSLSSLREQKELDLMDLVGEDRK
WMMARKLMQVNDTLTSEDAGLRNSKNCTEPALHEFPNDIFTNEDRRQGAVVLHVLCAIYM
FYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFITKGDVGV
GTIVGSAVFNILCIIGVCGLFAGQVVALSSWCLLRDSIYYTLSVIALIVFIYDEKVSWWE
SLVLVLMYLIYIVIMKYNACIHQCFERRTKGAGNMVNGLANNAEIDDSSNCDATVVLLKK
ANFHRKASVIMVDELLSAYPHQLSFSEAGLRIMITSHFPPKTRLSMASRMLINERQRLIN
SRAYTNGESEVAIKIPIKHTVENGTGPSSAPDRGVNGTRRDDVVAEAGNETENENEDNEN
DEEEEEDEDDDEGPYTPFDTPSGKLETVKWAFTWPLSFVLYFTVPNCNKPRWEKWFMVTF
ASSTLWIAAFSYMMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDM
AVSNSIGSNVFDILIGLGLPWALQTLAVDYGSYIRLNSRGLIYSVGLLLASVFVTVFGVH
LNKWQLDKKLGCGCLLLYGVFLCFSIMTEFNVFTFVNLPMCGDH
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgcggccgtccggcgacgaggaccgcgcgcgtcgccgccgccgccgccgccgccggagg
gaccttctgctgagccagctctgcttcctggcctcggtggcgctgctgctctggtcgctg
tcgagcctgcgagagcagaaggagcttgacctcatggacctcgtaggggaagacagaaag
tggatgatggcgaggaagctgatgcaggtgaacgacactctgacttccgaagatgccgga
ctccggaacagcaagaactgcaccgaaccagccctgcatgaattccccaatgacatcttc
acaaacgaggatagaagacaaggtgcggtggtcctccatgtgctctgtgccatatacatg
ttctatgcgctggccattgtgtgtgatgacttcttcgtcccttccttggaaaagatctgt
gagcgcctgcacctcagtgaagatgtggctggggccacattcatggcagcgggaagttcg
gccccagagctgttcacatcggtcataggggtcttcatcaccaaaggcgatgtgggagtt
ggcaccatcgtgggctcagcggtattcaacatcctgtgcatcattggtgtctgtgggctc
tttgctgggcaggttgtggctctttcctcctggtgcctgctgagggattctatttactac
acgctgtctgtgatcgcgctcatcgtgtttatttatgatgaaaaagtttcctggtgggag
tctttagtccttgtgctgatgtatcttatctacattgtcatcatgaaatataacgcttgc
atacatcagtgctttgagaggaggacaaaaggtgccgggaacatggtcaacggattggcc
aacaatgctgaaattgatgacagcagcaactgcgacgcaactgtggtgctacttaagaaa
gcaaatttccaccgcaaagcatcagtgatcatggtagacgagctgctgtcagcctaccca
caccagctttccttctctgaggctggccttcgaatcatgataaccagccactttcccccc
aagacccggctctccatggccagtcgcatgttgatcaatgagagacaaagattgataaac
agcagggcttataccaacggggaatctgaggtggccatcaaaatcccaattaagcacacc
gtggagaatgggacagggcccagcagtgccccagacaggggcgtgaatgggacacggagg
gacgatgttgtggctgaggctggcaacgaaacagagaatgaaaatgaggacaatgagaat
gatgaggaggaagaggaggacgaggatgatgatgaaggaccgtacacaccattcgacacc
ccctcgggtaaactggaaacagtgaaatgggcgttcacctggccgctgagtttcgtctta
tacttcactgtacccaactgcaacaagccgcgctgggagaaatggttcatggtgacgttt
gcttcctccacgctgtggatcgcagccttctcctacatgatggtgtggatggtcacaatc
attggttacaccctggggattcctgacgtcatcatggggatcaccttcctggctgctggg
accagcgtgcctgactgcatggccagcctcattgtggccagacaagggatgggggacatg
gctgtgtccaactccattgggagcaacgtgtttgacatcctgattggcctcggtctcccc
tgggctctgcagaccctggctgtggattacggatcctacatccggctgaatagcaggggg
ctgatctactccgtaggcttgctcctggcctctgtttttgtcacggtgttcggcgtccac
ctgaacaagtggcagctggacaagaagctgggctgtgggtgcctcctcctgtatggtgtg
ttcctgtgcttctccatcatgactgagttcaacgtgttcacctttgtgaacctgcccatg
tgcggggaccactga

DBGET integrated database retrieval system