KEGG   Homo sapiens (human): 5742
Entry
5742              CDS       T01001                                 

Gene name
PTGS1, COX1, COX3, PCOX1, PES-1, PGG/HS, PGHS-1, PGHS1, PHS1, PTGHS
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04611  Platelet activation
hsa04726  Serotonergic synapse
hsa04923  Regulation of lipolysis in adipocytes
Drug target
Aceclofenac: D01545
Acemetacin: D01582<JP>
Acetylsalicylic acid (DG00015): D00109<JP> D05181 D07579 D07580 D07581 D07582
Alminoprofen: D01513
Aloxiprin: D07421
Amfenac (DG01249): D01788 D07443
Ampiroxicam: D01397<JP>
Amtolmetin guacil: D07453
Benzydamine (except lozenges) (DG00014): D01410 D07516 D07517
Bromfenac (DG01128): D03163<JP/US> D07541
Bufexamac: D01271
Carprofen: D03410
Choline salicylate: D00810
Dexibuprofen (DG00756): D03715 D03718
Dexketoprofen: D07269
Diclofenac (DG00441): D00903<US> D00904<JP/US> D07816<US> D07817 D07818<US> D07819
Droxicam: D07267
Epidihydrocholesterin: D01527
Etofenamate: D04102
Felbinac (DG00764): D01675<JP> D01841
Fenbufen: D01344
Fenoprofen (DG00754): D00968<US> D02350
Flufenamic acid (DG00757): D01581 D01823<JP> D03254<JP>
Flurbiprofen (DG00755): D00330<JP/US> D01475<JP> D02290<US> D10254
Glycol salicylate: D01557
Ibuprofen (DG00245): D00126<JP/US> D01122<JP> D04490 D06606<JP/US> D08058 D08059 D09760
Ibuproxam: D07268
Indobufen: D07141
Indometacin (DG00241): D00141<JP/US> D01565<JP> D02110<JP/US>
Ketoprofen (DG00753): D00132<JP/US> D08102 D08103
Ketorolac (DG00751): D00813<US> D08104
Lornoxicam: D01866<JP>
Loxoprofen (DG01251): D01709<JP> D08149
Magnesium salicylate: D00827
Meclofenamic acid (DG00758): D00169<US> D02341 D08162
Mefenamic acid: D00151<JP/US>
Mofezolac: D01718<JP>
Nabumetone: D00425<JP/US>
Naproxcinod: D09568
Naproxen (DG00455): D00118<JP/US> D00970<US> D10017
Nepafenac: D05143<JP/US>
Orpanoxin: D05275
Oxaprozin: D00463<JP/US>
Oxyphenbutazone (DG00746): D05319 D08324
Pamicogrel: D01090
Paracetamol: D00217<JP/US>
Phenbutazone sodium glycerate: D05451
Phenylbutazone (DG00745): D00510 D08363 D08364
Piketoprofen (DG01250): D08374 D08375
Piroxicam (DG00752): D00127<JP/US> D05511 D05512 D05513
Pranoprofen: D01578<JP>
Pravadoline maleate: D05598
Proglumetacin (DG00750): D01765<JP> D08427
Propacetamol (DG00828): D07294 D08434
Salicylamide: D01811
Salicylate meglumine: D05791
Salsalate: D00428
Sodium salicylate: D00566<JP>
Sulindac: D00120<JP/US>
Tebufelone: D06017
Tenidap (DG00761): D06072 D06073
Tenoxicam: D01767
Tiaprofenic acid: D01325<JP>
Tolfenamic acid: D01183
Tolmetin (DG00747): D00158<US> D02355
Triflusal: D07142
Trolamine: D08501
Zaltoprofen: D01547<JP>
Zidometacin: D06364
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    5742 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5742 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    5742 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    5742 (PTGS1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     5742 (PTGS1)
SSDB
Motif
Pfam: An_peroxidase EGF EGF_2
Other DBs
NCBI-GeneID: 5742
NCBI-ProteinID: NP_000953
OMIM: 176805
HGNC: 9604
Ensembl: ENSG00000095303
Vega: OTTHUMG00000020605
Pharos: P23219(Tclin)
UniProt: P23219
Position
9q33.2
AA seq 599 aa
MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF
DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA
LVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL
VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgagccggagtctcttgctctggttcttgctgttcctgctcctgctcccgccgctcccc
gtcctgctcgcggacccaggggcgcccacgccagtgaatccctgttgttactatccatgc
cagcaccagggcatctgtgtccgcttcggccttgaccgctaccagtgtgactgcacccgc
acgggctattccggccccaactgcaccatccctggcctgtggacctggctccggaattca
ctgcggcccagcccctctttcacccacttcctgctcactcacgggcgctggttctgggag
tttgtcaatgccaccttcatccgagagatgctcatgcgcctggtactcacagtgcgctcc
aaccttatccccagtccccccacctacaactcagcacatgactacatcagctgggagtct
ttctccaacgtgagctattacactcgtattctgccctctgtgcctaaagattgccccaca
cccatgggaaccaaagggaagaagcagttgccagatgcccagctcctggcccgccgcttc
ctgctcaggaggaagttcatacctgacccccaaggcaccaacctcatgtttgccttcttt
gcacaacacttcacccaccagttcttcaaaacttctggcaagatgggtcctggcttcacc
aaggccttgggccatggggtagacctcggccacatttatggagacaatctggagcgtcag
tatcaactgcggctctttaaggatgggaaactcaagtaccaggtgctggatggagaaatg
tacccgccctcggtagaagaggcgcctgtgttgatgcactacccccgaggcatcccgccc
cagagccagatggctgtgggccaggaggtgtttgggctgcttcctgggctcatgctgtat
gccacgctctggctacgtgagcacaaccgtgtgtgtgacctgctgaaggctgagcacccc
acctggggcgatgagcagcttttccagacgacccgcctcatcctcataggggagaccatc
aagattgtcatcgaggagtacgtgcagcagctgagtggctatttcctgcagctgaaattt
gacccagagctgctgttcggtgtccagttccaataccgcaaccgcattgccatggagttc
aaccatctctaccactggcaccccctcatgcctgactccttcaaggtgggctcccaggag
tacagctacgagcagttcttgttcaacacctccatgttggtggactatggggttgaggcc
ctggtggatgccttctctcgccagattgctggccggatcggtgggggcaggaacatggac
caccacatcctgcatgtggctgtggatgtcatcagggagtctcgggagatgcggctgcag
cccttcaatgagtaccgcaagaggtttggcatgaaaccctacacctccttccaggagctc
gtaggagagaaggagatggcagcagagttggaggaattgtatggagacattgatgcgttg
gagttctaccctggactgcttcttgaaaagtgccatccaaactctatctttggggagagt
atgatagagattggggctcccttttccctcaagggtctcctagggaatcccatctgttct
ccggagtactggaagccgagcacatttggcggcgaggtgggctttaacattgtcaagacg
gccacactgaagaagctggtctgcctcaacaccaagacctgtccctacgtttccttccgt
gtgccggatgccagtcaggatgatgggcctgctgtggagcgaccatccacagagctctga

DBGET integrated database retrieval system