KEGG   Homo sapiens (human): 57453
Entry
57453             CDS       T01001                                 

Gene name
DSCAML1, DSCAM2
Definition
(RefSeq) DS cell adhesion molecule like 1
  KO
K06768  Down syndrome cell adhesion molecule-like protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    57453 (DSCAML1)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  DSCAM family
   57453 (DSCAML1)
SSDB
Motif
Pfam: I-set Ig_3 fn3 Ig_2 ig V-set C2-set_2 Ig_6 C1-set Pur_ac_phosph_N Receptor_2B4 Interfer-bind fn3_2 ChitinaseA_N
Other DBs
NCBI-GeneID: 57453
NCBI-ProteinID: NP_065744
OMIM: 611782
HGNC: 14656
Ensembl: ENSG00000177103
Vega: OTTHUMG00000167071
Pharos: Q8TD84(Tbio)
UniProt: Q8TD84 A0A384DVL8
Structure
PDB: 
1VA9

Position
11q23.3
AA seq 2053 aa
MWLVTFLLLLDSLHKARPEDVGTSLYFVNDSLQQVTFSSSVGVVVPCPAAGSPSAALRWY
LATGDDIYDVPHIRHVHANGTLQLYPFSPSAFNSFIHDNDYFCTAENAAGKIRSPNIRVK
AVFREPYTVRVEDQRSMRGNVAVFKCLIPSSVQEYVSVVSWEKDTVSIIPEHRFFITYHG
GLYISDVQKEDALSTYRCITKHKYSGETRQSNGARLSVTDPAESIPTILDGFHSQEVWAG
HTVELPCTASGYPIPAIRWLKDGRPLPADSRWTKRITGLTISDLRTEDSGTYICEVTNTF
GSAEATGILMVIDPLHVTLTPKKLKTGIGSTVILSCALTGSPEFTIRWYRNTELVLPDEA
ISIRGLSNETLLITSAQKSHSGAYQCFATRKAQTAQDFAIIALEDGTPRIVSSFSEKVVN
PGEQFSLMCAAKGAPPPTVTWALDDEPIVRDGSHRTNQYTMSDGTTISHMNVTGPQIRDG
GVYRCTARNLVGSAEYQARINVRGPPSIRAMRNITAVAGRDTLINCRVIGYPYYSIKWYK
DALLLPDNHRQVVFENGTLKLTDVQKGMDEGEYLCSVLIQPQLSISQSVHVAVKVPPLIQ
PFEFPPASIGQLLYIPCVVSSGDMPIRITWRKDGQVIISGSGVTIESKEFMSSLQISSVS
LKHNGNYTCIASNAAATVSRERQLIVRVPPRFVVQPNNQDGIYGKAGVLNCSVDGYPPPK
VMWKHAKGSGNPQQYHPVPLTGRIQILPNSSLLIRHVLEEDIGYYLCQASNGVGTDISKS
MFLTVKIPAMITSHPNTTIAIKGHAKELNCTARGERPIIIRWEKGDTVIDPDRVMRYAIA
TKDNGDEVVSTLKLKPADRGDSVFFSCHAINSYGEDRGLIQLTVQEPPDPPELEIREVKA
RSMNLRWTQRFDGNSIITGFDIEYKNKSDSWDFKQSTRNISPTINQANIVDLHPASVYSI
RMYSFNKIGRSEPSKELTISTEEAAPDGPPMDVTLQPVTSQSIQVTWKAPKKELQNGVIR
GYQIGYRENSPGSNGQYSIVEMKATGDSEVYTLDNLKKFAQYGVVVQAFNRAGTGPSSSE
INATTLEDVPSQPPENVRALSITSDVAVISWSEPPRSTLNGVLKGYRVIFWSLYVDGEWG
EMQNITTTRERVELRGMEKFTNYSVQVLAYTQAGDGVRSSVLYIQTKEDVPGPPAGIKAV
PSSASSVVVSWLPPTKPNGVIRKYTIFCSSPGSGQPAPSEYETSPEQLFYRIAHLNRGQQ
YLLWVAAVTSAGRGNSSEKVTIEPAGKAPAKIISFGGTVTTPWMKDVRLPCNSVGDPAPA
VKWTKDSEDSAIPVSMDGHRLIHTNGTLLLRAVKAEDSGYYTCTATNTGGFDTIIVNLLV
QVPPDQPRLTVSKTSASSITLTWIPGDNGGSSIRGFVLQYSVDNSEEWKDVFISSSERSF
KLDSLKCGTWYKVKLAAKNSVGSGRISEIIEAKTHGREPSFSKDQHLFTHINSTHARLNL
QGWNNGGCPITAIVLEYRPKGTWAWQGLRANSSGEVFLTELREATWYELRMRACNSAGCG
NETAQFATLDYDGSTIPPIKSAQGEGDDVKKLFTIGCPVILATLGVALLFIVRKKRKEKR
LKRLRDAKSLAEMLISKNNRSFDTPVKGPPQGPRLHIDIPRVQLLIEDKEGIKQLGDDKA
TIPVTDAEFSQAVNPQSFCTGVSLHHPTLIQSTGPLIDMSDIRPGTNPVSRKNVKSAHST
RNRYSSQWTLTKCQASTPARTLTSDWRTVGSQHGVTVTESDSYSASLSQDTDKGRNSMVS
TESASSTYEELARAYEHAKLEEQLQHAKFEITECFISDSSSDQMTTGTNENADSMTSMST
PSEPGICRFTASPPKPQDADRGKNVAVPIPHRANKSDYCNLPLYAKSEAFFRKADGREPC
PVVPPREASIRNLARTYHTQARHLTLDPASKSLGLPHPGAPAAASTATLPQRTLAMPAPP
AGTAPPAPGPTPAEPPTAPSAAPPAPSTEPPRAGGPHTKMGGSRDSLLEMSTSGVGRSQK
QGAGAYSKSYTLV
NT seq 6162 nt   +upstreamnt  +downstreamnt
atgtggctggtaactttcctcctgctcctggactctttacacaaagcccgccctgaagat
gttggcaccagcctctactttgtaaatgactccttgcagcaggtgaccttttccagctcc
gtgggggtggtggtgccctgcccggccgcgggctcccccagcgcggcccttcgatggtac
ctggccacaggggacgacatctacgacgtgccgcacatccggcacgtccacgccaacggg
acgctgcagctctaccccttctccccctccgccttcaatagctttatccacgacaatgac
tacttctgcaccgcggagaacgctgccggcaagatccggagccccaacatccgcgtcaaa
gcagttttcagggaaccctacaccgtccgggtggaggatcaaaggtcaatgcgtggcaac
gtggccgtcttcaagtgcctcatcccctcttcagtgcaggaatatgttagcgttgtatct
tgggagaaagacacagtctccatcatcccagaacacaggttttttattacctaccacggc
gggctgtacatctctgacgtacagaaggaggacgccctctccacctatcgctgcatcacc
aagcacaagtatagcggggagacccggcagagcaatggggcacgcctctctgtgacagac
cctgctgagtcgatccccaccatcctggatggcttccactcccaggaagtgtgggccggc
cacaccgtggagctgccctgcaccgcctcgggctaccctatccccgccatccgctggctc
aaggatggccggcccctcccggctgacagccgctggaccaagcgcatcacagggctgacc
atcagcgacttgcggaccgaggacagcggcacctacatttgtgaggtcaccaacaccttc
ggttcggcagaggccacaggcatcctcatggtcattgatccccttcatgtgaccctgaca
ccaaagaagctgaagaccggcattggcagcacggtcatcctctcctgtgccctgacgggc
tccccagagttcaccatccgctggtatcgcaacacggagctggtgctgcctgacgaggcc
atctccatccgcgggctcagcaacgagacgctgctcatcacctcggcccagaagagccat
tccggggcctaccagtgcttcgctacccgcaaggcccagaccgcccaggactttgccatc
attgcacttgaggatggcacgccccgcatcgtctcgtccttcagcgagaaggtggtcaac
cccggggagcagttctcactgatgtgtgcggccaagggcgccccgccccccacggtcacc
tgggccctcgacgatgagcccatcgtgcgggatggcagccaccgcaccaaccagtacacc
atgtcggacggcaccaccatcagccacatgaacgtcacaggcccccagatccgcgacggg
ggcgtgtaccggtgcacagcgcggaacttggtgggcagtgctgaatatcaggcgcgaata
aacgtaagaggcccacccagcatccgggctatgcggaacatcacagcagtcgccgggcgg
gacacccttatcaactgcagggtcatcggctatccctactactccatcaagtggtacaag
gatgccctgctgctgccagacaaccaccgccaggtggtgtttgagaatgggaccctcaag
ctgactgacgtgcagaagggcatggatgagggggagtacctgtgcagtgtcctcatccag
ccccagctctccatcagccagagcgttcacgtagccgtcaaagtgccccctctgatccag
cccttcgaattcccacccgcctccatcggccagctgctctacattccctgtgtggtgtcc
tcgggggacatgcccatccgtatcacctggaggaaggacggacaggtgatcatctcaggc
tcgggcgtgaccatcgagagcaaggaattcatgagctccctgcagatctctagcgtctcc
ctcaagcacaacggcaactatacatgcatcgccagcaacgcagccgccaccgtgagccgg
gagcgccagctcatcgtgcgtgtgccccctcgatttgtggtgcaacccaacaaccaggat
ggcatctacggcaaagctggtgtgctcaactgctcggtggacggctaccccccacccaag
gtcatgtggaagcatgccaaggggagcgggaacccccagcagtaccaccctgtgcccctc
actggccgcatccagatcctgcccaacagctcgctgctgatccgccacgtcctagaagag
gacatcggctactacctctgccaggccagcaacggcgtaggcaccgacatcagcaagtcc
atgttcctcacagtcaagatcccggccatgatcacttcccaccccaacaccaccatcgcc
atcaagggccatgcgaaggagctaaactgcacggcacggggtgagcggcccatcatcatc
cgctgggagaagggggacacagtcatcgaccctgaccgcgtcatgcggtatgccatcgcc
accaaggacaacggcgacgaggtcgtctccacactgaagctcaagcccgctgaccgtggg
gactctgtgttcttcagctgccatgccatcaactcgtatggggaggaccggggcttgatc
caactcactgtgcaagagccccccgaccccccagagctggagatccgggaggtgaaggcc
cggagcatgaacctgcgctggacccagcgattcgacgggaacagcatcatcacgggcttc
gacattgaatacaagaacaaatcagattcctgggacttcaagcagtccacacgcaacatc
tcccccaccatcaaccaggccaacattgtggacttgcacccggcatctgtgtacagcatc
cgcatgtactctttcaacaagattggccgcagtgaaccaagcaaggagctcaccatcagc
actgaggaggccgctcccgatgggccccccatggatgttaccttgcagccagtgacctca
cagagcatccaggtgacctggaaggcacccaagaaggagctgcagaacggtgtcatccgg
ggctaccagattggctacagagagaacagccccggcagcaacgggcagtacagcatcgtg
gagatgaaggccacgggggacagcgaggtctacaccctggacaacctcaagaagttcgcc
cagtatggggtggtggtccaagccttcaatcgggctggcacggggccctcttccagcgag
atcaatgccaccactctggaggatgtgcccagccagccccctgagaacgtccgggccctg
tccatcacttctgacgtggccgtcatctcctggtcagagcccccgcgcagcaccctcaat
ggcgtcctcaaaggctatcgggtcatcttctggtccctctatgttgatggggagtggggc
gagatgcagaacatcaccaccacgcgggagcgggtggagctgcggggcatggagaagttc
accaactacagcgtccaggtgctggcctacacccaggctggggacggcgtacgcagcagt
gtgctctacatccagaccaaggaggacgttccaggtccccctgctggcatcaaagctgtc
ccttcatcagctagcagtgtggttgtgtcttggctcccccctaccaagcccaacggggtg
atccgcaagtacaccatcttctgttccagccccgggtctggccagccggctcccagcgag
tacgagacgagtccagagcagctcttctaccggatcgcccacctaaaccgcggtcagcag
tatctgctgtgggtggccgccgtcacctctgccggccggggcaacagcagcgagaaggtg
accatcgagcctgctggcaaggccccagcaaagatcatctcctttgggggcaccgtgaca
acaccttggatgaaagatgttcggctgccttgcaattcagtgggagatccagcccctgct
gtgaagtggaccaaggacagtgaagactcggccattccagtgtccatggatgggcaccgg
ctcatccacaccaatggcacactgctgctgcgtgcagtgaaggctgaggactctggctac
tacacgtgcacggccaccaacactggtggctttgacaccatcatcgtcaaccttctggtg
caagttcccccggaccagccccgcctcactgtctccaaaacctcagcttcgtccatcacc
ctgacctggattccaggtgacaatgggggcagctccatccgaggcttcgtgctacagtac
tcggtggacaacagcgaggagtggaaggatgtgttcatcagctccagcgagcgctccttc
aagctggacagcctcaagtgtggcacgtggtacaaggtgaagctggcagccaagaacagc
gtgggctctgggcgcatcagcgagatcatcgaggccaagacccacgggcgggagccctcc
ttcagcaaagaccaacacctcttcacccacatcaactccacgcatgctcggcttaacctg
cagggctggaacaatgggggctgccctatcacagccatcgttctggagtaccggcccaag
gggacctgggcctggcagggcctccgggccaacagctccggggaggtgtttctgacggaa
ctgcgagaggccacgtggtacgagctgcgcatgagggcttgcaacagtgcgggctgcggc
aatgaaacagcccagttcgccaccctggactacgatggcagcaccattccacccatcaag
tctgctcaaggtgaaggggatgatgtgaagaagctgttcaccatcggctgccctgtcatc
ctggccacactgggggtggcactgctcttcatcgtacgcaagaagaggaaggagaaacgg
ctgaagcgactccgagatgcaaagagtttggcagaaatgttgataagcaagaacaataga
agctttgacacccctgtgaaagggccaccccagggcccacggctacacattgacatcccc
agggtccagctgctcatcgaggacaaagaaggcatcaagcaactgggagatgacaaggcc
accatccctgtgacagatgctgagttcagccaagctgtcaacccacagagcttctgtact
ggcgtctccttgcaccacccaaccctcatccagagcacaggacccctcatcgacatgtct
gacatccggccaggaaccaatccagtgtccaggaagaatgtgaagtcagcccacagcacc
cggaaccggtactcaagccagtggaccctgaccaagtgccaggcctccacacctgcccgc
accctcacctccgactggcgcaccgtgggctcccagcatggtgtcacggtcactgagagt
gacagctacagtgccagcctgtcccaggacacagacaaaggaaggaacagcatggtgtcc
actgagagtgcctcttccacctacgaggagctggcccgggcctatgagcatgccaagctg
gaggagcagctgcagcacgccaagtttgagatcaccgagtgcttcatctctgacagttcc
tctgaccagatgaccacaggcaccaacgagaacgccgacagcatgacatccatgagcaca
ccctcagagcctggcatctgccgctttaccgcctcaccacccaagccccaggatgcggac
cggggcaaaaacgtggctgtgcccatccctcaccgggccaacaagagtgactactgcaac
ctgcccctgtatgccaagtcagaggccttctttcgaaaggcagatggacgtgagccctgc
cccgtggtcccaccccgtgaggcctccatccggaacctggctcgaacctaccacacccag
gctcgccacctgaccctggaccctgccagcaagtccttgggccttccccacccaggggcc
cccgctgccgcctccacagccaccttacctcagaggactctggccatgccagccccccca
gccggcacagcccccccagcccccggccccacccctgctgagccacccaccgcccccagc
gctgcccctccggcccccagcaccgagcctccacgagccgggggcccacacaccaaaatg
gggggctccagggactcgcttctcgagatgagcacatcgggggtagggaggtctcagaag
cagggggccggggcctactccaaatcctacaccctggtgtag

DBGET integrated database retrieval system