KEGG   Homo sapiens (human): 57463
Entry
57463             CDS       T01001                                 
Symbol
AMIGO1, ALI2, AMIGO, AMIGO-1
Name
(RefSeq) adhesion molecule with Ig like domain 1
  KO
K22529  amphoterin-induced protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    57463 (AMIGO1)
SSDB
Motif
Pfam: LRR_8 LRR_4 I-set V-set LRR_9 Ig_3 ig LRR_5 Izumo-Ig Ig_2 Ig_6
Other DBs
NCBI-GeneID: 57463
NCBI-ProteinID: NP_065754
OMIM: 615689
HGNC: 20824
Ensembl: ENSG00000181754
Pharos: Q86WK6(Tbio)
UniProt: Q86WK6
Position
1:complement(109504178..109509727)
AA seq 493 aa
MHPHRDPRGLWLLLPSLSLLLFEVARAGRAVVSCPAACLCASNILSCSKQQLPNVPHSLP
SYTALLDLSHNNLSRLRAEWTPTRLTQLHSLLLSHNHLNFISSEAFSPVPNLRYLDLSSN
QLRTLDEFLFSDLQVLEVLLLYNNHIMAVDRCAFDDMAQLQKLYLSQNQISRFPLELVKE
GAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHNNPLNCDCELYQLFSHWQYRQ
LSSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCDTKQQGMTKV
WVTPSNERVLDEVTNGTVSVSKDGSLLFQQVQVEDGGVYTCYAMGETFNETLSVELKVHN
FTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLS
TTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPE
SVSSVFSDTPIVV
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgcacccccaccgtgacccgagaggcctctggctcctgctgccgtccttgtccctgctg
ctttttgaggtggccagagctggccgagccgtggttagctgtcctgccgcctgcttgtgc
gccagcaacatcctcagctgctccaagcagcagctgcccaatgtgccccattccttgccc
agttacacagcactactggacctcagtcacaacaacctgagccgcctgcgggccgagtgg
acccccacgcgcctgacccaactgcactccctgctgctgagccacaaccacctgaacttc
atctcctctgaggccttttccccggtacccaacctgcgctacctggacctctcctccaac
cagctgcgtacactggatgagttcctgttcagtgacctgcaagtactggaggtgctgctg
ctctacaataaccacatcatggcggtggaccggtgcgccttcgatgacatggcccagctg
cagaaactctacttgagccagaaccagatctctcgcttccctctggaactggtcaaggaa
ggagccaagctacccaaactaacgctcctggatctctcttctaacaagctgaagaacttg
ccattgcctgacctgcagaagctgccggcctggatcaagaatgggctgtacctacataac
aaccccctgaactgcgactgtgagctctaccagctgttttcacactggcagtatcggcag
ctgagctccgtgatggactttcaagaggatctgtactgcatgaactccaagaagctgcac
aatgtcttcaacctgagtttcctcaactgtggcgagtacaaggagcgtgcctgggaggcc
cacctgggtgacaccttgatcatcaagtgtgacaccaagcagcaagggatgaccaaggtg
tgggtgacaccaagtaatgaacgggtgctagatgaggtgaccaatggcacagtgagtgtg
tctaaggatggcagtcttcttttccagcaggtgcaggtcgaggacggtggtgtgtatacc
tgctatgccatgggagagactttcaatgagacactgtctgtggaattgaaagtgcacaat
ttcaccttgcacggacaccatgacaccctcaacacagcctataccaccctagtgggctgt
atccttagtgtggtcctggtcctcatatacctatacctcaccccttgccgctgctggtgc
cggggtgtagagaagccttccagccatcaaggagacagcctcagctcttccatgcttagt
accacacccaaccatgatcctatggctggtggggacaaagatgatggttttgaccggcgg
gtggctttcctggaacctgctggacctgggcagggtcaaaacggcaagctcaagccaggc
aacaccctgccagtgcctgaggccacaggcaagggccaacggaggatgtcggatccagaa
tcagtcagctcggtcttctctgatacgcccattgtggtgtga

DBGET integrated database retrieval system