KEGG   Homo sapiens (human): 57474
Entry
57474             CDS       T01001                                 

Gene name
ZNF490
Definition
(RefSeq) zinc finger protein 490
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    57474 (ZNF490)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    57474 (ZNF490)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    57474 (ZNF490)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_11 zf-trcl zf-C2H2_jaz DUF3268 zinc_ribbon_15 Zn-ribbon_8 Zn_ribbon_SprT zf-met DUF5830
Other DBs
NCBI-GeneID: 57474
NCBI-ProteinID: NP_065765
HGNC: 23705
Ensembl: ENSG00000188033
Vega: OTTHUMG00000156398
Pharos: Q9ULM2(Tdark)
UniProt: Q9ULM2
Position
19p13.2-p13.13
AA seq 529 aa
MRRNSSLSFQMERPLEEQVQSKWSSSQGRTGTGGSDVLQMQNSEHHGQSIKTQTDSISLE
DVAVNFTLEEWALLDPGQRNIYRDVMRATFKNLACIGEKWKDQDIEDEHKNQGRNLRSPM
VEALCENKEDCPCGKSTSQIPDLNTNLETPTGLKPCDCSVCGEVFMHQVSLNRHMRSHTE
QKPNECHEYGEKPHKCKECGKTFTRSSSIRTHERIHTGEKPYECKECGKAFAFLFSFRNH
IRIHTGETPYECKECGKAFRYLTALRRHEKNHTGEKPYKCKQCGKAFIYYQPFLTHERTH
TGEKPYECKQCGKAFSCPTYLRSHEKTHTGEKPFVCRECGRAFFSHSSLRKHVKTHTGVQ
PYTCKKCGEAFKSSSSCEVHERTHFGEKPYECKQCGKAFNSSSYLQLHERVHTGEKTYEC
KECGKAFLYSTHFRIHERTHTREKPYECKQCGRVFIYFSHLRRHERSHTGVKPCECKQCG
KAFTCLNSLKVHKRIHTGERPFQCRQCGKAFSYSKSLHVHERTHSRQKP
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgcgcaggaattccagtctcagtttccagatggagcgacccctcgaggagcaagtccag
agcaagtggtcgtctagtcaaggccgcacaggaacaggagggtctgatgtcctccagatg
cagaacagtgaacaccatggacaaagcatcaagactcaaactgactccatctcccttgag
gatgtggctgtgaacttcaccctggaggagtgggctttgctggatcctggccagaggaat
atctacagagatgtgatgcgggcaaccttcaagaacctggcctgtataggggaaaaatgg
aaagaccaggatattgaagatgaacacaaaaaccagggaagaaatctaagaagtcctatg
gttgaagcactctgtgaaaataaagaagattgtccatgtggaaaaagcactagccagatt
cctgatcttaatacgaacctggaaactcctactggattaaaaccatgtgactgcagtgtg
tgtggggaagtcttcatgcatcaggtctcccttaataggcacatgagatctcacactgaa
cagaaaccaaatgagtgtcacgaatatggagagaagccacataaatgcaaagaatgtggg
aaaaccttcactcgcagctccagtattcgaacccatgaaagaattcacactggagagaaa
ccctatgaatgtaaggaatgtggcaaagccttcgcatttctcttttcctttcgaaaccat
ataagaattcatactggagagacaccctatgaatgtaaggaatgtgggaaggcattcaga
tatctcactgctcttcggcgccatgaaaaaaatcacactggagagaaaccctacaaatgt
aaacagtgtggaaaagcctttatatattaccagccttttctaacccacgaaaggactcac
actggagagaaaccttatgaatgtaagcaatgtgggaaagccttcagttgtcccacgtac
ttacggagtcatgagaaaactcatactggagagaaaccttttgtatgtagggaatgtggg
agagccttcttttctcactcaagccttcgaaaacacgtgaaaacccacaccggagttcaa
ccttatacatgtaagaaatgtggggaagccttcaagtcatctagttcctgtgaagtgcac
gaaagaactcattttggagaaaaaccctatgaatgtaaacaatgtggtaaagccttcaat
tcttcaagttaccttcagttgcacgaaagagttcacactggcgagaaaacttacgaatgt
aaagaatgtggtaaagcctttctttattccactcactttcgaatccatgaaagaacccat
actagagagaaaccctatgaatgcaaacagtgtggtcgggtcttcatttacttcagtcac
cttcgaaggcacgaaagaagtcacactggagtgaaaccatgtgagtgtaagcagtgtggc
aaagctttcacttgtttaaattccctgaaagtacacaaaagaattcatactggagaaaga
ccctttcagtgtagacaatgtggtaaagccttcagttactcaaagtctttgcacgtgcac
gaaaggactcatagtagacagaagccctaa

DBGET integrated database retrieval system