KEGG   Homo sapiens (human): 57475Help
Entry
57475             CDS       T01001                                 

Gene name
PLEKHH1
Definition
(RefSeq) pleckstrin homology, MyTH4 and FERM domain containing H1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MyTH4 PH FERM_M PH_11 PH_3
Motif
Other DBs
NCBI-GeneID: 57475
NCBI-ProteinID: NP_065766
HGNC: 17733
Ensembl: ENSG00000054690
Vega: OTTHUMG00000171272
Pharos: Q9ULM0(Tdark)
UniProt: Q9ULM0
Position
14q24.1
AA seq 1364 aa AA seqDB search
MAELKVEAPASVDWQKRCLTLETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENA
ETQVGVMEEKVKLSNLKNVDSEGSLHRKYQELLKAIKGKDELISQLEAQLEKQKQMRAEE
AKTVQEKAAKIKEWVTLKLAKLEMENQHLKSHNQRLVEQVGSLQDALEAIQIAPSRKLLV
PPYGAAEQDSVPSEPGIQPMGQDSGSQAQGLKAAVLAPSPGALQSKDSVSEAASPLEDSS
SSTVHSGETVEAKPLQPHLGRESPPHQPCMKLLTFRCSSASWGEGLVTAQRGMLPGTKTS
AREGGPGSSLTLPKVRAPGTPRDSIQLAKRHHSQPQVGHGHFGRVVNIETEAFSALHPSG
LPELESRARSREEPEKMEMEEPPPAGKNEERESPKALGAELEEVELGNKPPTPPLHQFSS
WESRIYAVATSGMRLSDMSPRSNTACCASSPPALVSPGSFSGLVYKNVTVPVYTALKGRA
TQISNMPFMDESSGSDDDCSSQASFRISVPSSESRKTSGLGSPRAIKRGVSMSSLSSEGD
YAIPPDACSLDSDYSEPEHKLQRTSSYSTDGLGLGGESLEKSGYLLKMGSQVKTWKRRWF
VLRQGQIMYYKSPSDVIRKPQGQVDLNSRCQIVRGEGSQTFQLISEKKTYYLTADSPSLL
EEWIRVLQSLLKVQATGPPALLRGGTKPTVKGWLTKVKHGHSKVVWCALVGKIFYYYRSH
EDKRPLGCLPVRDAHIEEVDRSCDSDEDYEAGGTRRLLSSHCTLVIHPTEHSPTYLLIGT
KHEKDTWLYHLTVAAGGSSAKVGTAYEQLIGKLMDGEGDPDSPLWRHPMLCYSKDGLYAS
LTTLPSEALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTALQVCLVHPELQSEIYCQ
LMKQTSCRPPQKYSLMQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRSETGQYATYC
QRAVERTLRTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFTNGTYHVVGFDGSSTVD
EFLQRLNQEIGMRKPSHSGFALFTDDPSGRDLEHCLQGSVKICDAISKWEQAMKELHPGK
SEGGTRVVKLMYKNRLYFRSQVKGETDRERLLLASQTSREIVAGRFPINKELALEMAALM
AQVEYGDLEKPALPGPGGTSPAKAQHLLQQVLDRFHPRRYRHGAPAEQLRHLADMLTTKW
ATLQGCSPPECIRIYLTVARKWPFFGAKLFAAQPAQLSSKENALVWIAVNEDGVSILDHN
TMQVHITYPYSSVTTFGGCRDDFMLVIRSIPDKSSGKSHIEKLIFRMAAPKIAEATFIMA
SYMNHCTTTVNPPTNPPGACQLWELDGRQFFSSVSCATKGPTLL
NT seq 4095 nt NT seq  +upstreamnt  +downstreamnt
atggcagaactcaaggtggaggcgccggccagcgtagactggcagaaacgctgcctgacc
ctggaaactcagcttttccggttccgcctacaggccagcaagataagggagctgctggct
gacaagatgcaggagctggagcagaggctgctggaggcagagcagagagcagagaacgct
gagacccaggtgggtgtcatggaagagaaggtaaaactatccaatctgaagaatgtggac
tctgaggggagcctgcaccggaaataccaagaattgctgaaagccataaagggcaaagat
gagctcatcagccagctagaggctcagctggagaagcagaagcagatgagggcagaggaa
gcaaaaactgttcaagaaaaagctgcaaagatcaaggaatgggtgacactcaagttggca
aagcttgagatggagaatcagcatctgaaaagccataatcagcgcctggtggagcaggtg
ggatcccttcaagatgcgctagaagctattcagatagctccttcacggaagctgctggtg
cccccctacggagctgcagagcaggattctgtcccttcagagccgggaatccagcctatg
ggccaggacagtggctcccaggcccagggtctgaaggcagctgtgcttgcaccttcccca
ggtgccctgcagagcaaggactctgtttctgaagcagcaagccccttggaggattctagt
tccagcacggtccattctggggaaacagtagaggccaagccccttcaacctcatctggga
agagagagccctccccaccagccatgcatgaagcttcttaccttcagatgtagttcagct
tcctggggtgagggtctggttactgctcagagagggatgctccctgggacaaagacctct
gccagggaaggtggtcctggcagcagtctgaccctaccaaaggtgcgggctcctggcacc
ccgcgggacagcatccagttggccaaaaggcaccacagccagccccaggtgggccatggg
cactttggccgtgtggtgaacattgagactgaggccttctcagccctccacccctctggc
cttcctgagctggagtcccgagctaggtcccgggaggaaccagagaagatggagatggag
gagccacccccagcagggaagaatgaggaaagagagagcccaaaggcccttggagctgag
ctggaggaagtggagctgggtaacaagccacctacacccccgctgcaccagttttcatcc
tgggagagccggatctatgctgtggccacatcgggcatgcggctctcagatatgtctccc
agaagtaatactgcatgctgcgcttcaagccctcctgcccttgtttcccctgggtctttc
tctggcctggtctacaagaatgtcactgtgcctgtctacacagcactgaaggggagagct
acacagatcagcaacatgccctttatggacgagtcctctgggtctgacgatgactgcagc
tctcaggcgagtttccgaatctcggtcccctcctctgagtccaggaagaccagcggacta
ggcagcccccgggccatcaagagaggcgtctccatgtcctcactgagctccgagggtgac
tacgccatccccccggacgcctgctcactggacagtgactactcagagcctgagcacaaa
ctgcagcgcacctcatcctactccaccgacgggctgggcctgggcggggagtcactggag
aagtcgggctacctgctgaaaatggggagccaggtgaagacgtggaagaggcgctggttt
gtcctgagacagggacagattatgtactacaagtccccgagtgatgtcatccggaaacct
caaggccaagtggatctgaactcccgctgccaaattgttcgaggggagggttcacagacg
tttcagctcatctctgagaagaaaacctactacctgacggccgattcacccagcctgctg
gaggagtggatccgagtactccagagcctgctgaaggtgcaggccaccgggcctccagct
ctgcttcggggtggcaccaagcccaccgtgaagggctggctgaccaaggtaaagcatggc
cactccaaggtggtctggtgcgctcttgttgggaaaatcttctactactatcggagccat
gaggacaagcgacccctgggctgcctgcctgtgcgggatgcgcacatagaggaagtagat
cgatcctgtgactcagacgaggactatgaggctggaggaaccagacggttgctttcctcc
cactgcaccctggtgatccaccccacagagcacagccccacctacctcctcattggcacc
aagcatgaaaaggatacgtggctctaccacctcacagtggctgcaggtggcagcagtgcc
aaggtgggcactgcctatgagcagctcattggaaaactgatggatggtgaaggagatcca
gattcgccgctctggaggcaccccatgctgtgctacagcaaagacggcctatacgcctcc
ctcaccaccctgccctctgaggccttgcagacggaggccctcaagctcttcaagtcctgc
cagctcttcatcaacgtgccggtggaagctgcctcggtggactaccatgtgtccctggcc
cagaccgcactgcaggtctgcctggttcaccccgagctgcagagtgagatctactgccaa
ctcatgaagcagaccagctgccgcccacctcagaagtactccctcatgcagtgctggcag
ctcctcgctctgtgtgctccacttttcctgcctcagcatcacttcctctggtatgtcaag
cagcagctccaacgccatgcagatcccagaagtgaaactggccagtatgccacctactgc
cagcgggcagtggagcggaccctgcggaccggggagcgggaagccaggccatcgcgcatg
gaagtggtgtccatcctgctgcgtaaccccttccaccactccttgcccttcagcatcccc
gtgcactttaccaacgggacttaccatgtggttggttttgacggctcttccacggttgat
gagttcctccagcggctgaaccaggagataggcatgagaaagccatcccactctggcttt
gccctcttcacggacgatccctcgggcagggacctggagcactgcctgcagggaagtgtc
aagatctgtgatgccatctccaagtgggaacaagccatgaaggagctgcaccccggaaag
tctgagggtgggacacgcgtcgtgaagctgatgtacaagaacaggctgtactttcgcagt
caagtcaaaggggagacggaccgagaacggctgctccttgcctctcaaaccagtagagag
atagtggcagggaggtttcctatcaacaaggaattggctcttgagatggctgccctgatg
gcccaggtagaatatggggacttggagaagcctgccctgccaggccctggaggcacatcc
cctgccaaggctcagcatcttctccagcaggtcctagacaggttccaccccaggcgctat
agacatggggcccccgctgaacagctgaggcacctggcagatatgttgaccacaaaatgg
gcaacattgcaaggatgctcccctcctgagtgcatccgcatctacctgaccgtggccagg
aaatggcctttctttggtgctaaactttttgctgctcagcctgcccagctgtcttccaag
gagaacgctctggtgtggattgctgtgaatgaggatggcgtcagcatcctggaccacaac
actatgcaagtgcacatcacttacccctactcttcagtgacaacgtttggtggctgcagg
gatgacttcatgcttgtgattagatctatcccagacaagagctctggaaaaagccacatt
gagaagttgatcttccggatggctgctcccaagattgcagaagctaccttcatcatggcc
agctatatgaaccattgcactacaactgtgaacccccccaccaacccacccggagcctgc
cagctgtgggaactggatggacgacagttcttttcttctgtttcctgtgctaccaagggg
ccaacgttgctgtga

DBGET integrated database retrieval system