KEGG   Homo sapiens (human): 57476
Entry
57476             CDS       T01001                                 

Gene name
GRAMD1B, LINC01059
Definition
(RefSeq) GRAM domain containing 1B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: VASt GRAM
Other DBs
NCBI-GeneID: 57476
NCBI-ProteinID: NP_065767
HGNC: 29214
Ensembl: ENSG00000023171
Vega: OTTHUMG00000166004
Pharos: Q3KR37(Tdark)
UniProt: Q3KR37
Position
11q24.1
AA seq 738 aa
MKGFKLSCTASNSNRSTPACSPILRKRSRSPTPQNQDGDTMVEKGSDHSSDKSPSTPEQG
VQRSCSSQSGRSGGKNSKKSQSWYNVLSPTYKQRNEDFRKLFKQLPDTERLIVDYSCALQ
RDILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTDSEK
HFFTSFGARDRTYMMMFRLWQNALLEKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDD
DFNTMGYCEEIPVEENEVNDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFD
GLPLEEEALEGDGSLEKELAIDNIMGEKIEMIAPVNSPSLDFNDNEDIPTELSDSSDTHD
EGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFQRDFMEQRRFSDIIFHPWKKEE
NGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYT
INRYTLTRVARNKSRLRVSTELRYRKQPWGLVKTFIEKNFWSGLEDYFRHLESELAKTES
TYLAEMHRQSPKEKASKTTTVRRRKRPHAHLRVPHLEEVMSPVTTPTDEDVGHRIKHVAG
STQTRHIPEDTPNGFHLQSVSKLLLVISCVICFSLVLLVILNMMLFYKLWMLEYTTQTLT
AWQGLRLQERLPQSQTEWAQLLESQQKYHDTELQKWREIIKSSVMLLDQMKDSLINLQNG
IRSRDYTSESEEKRNRYH
NT seq 2217 nt   +upstreamnt  +downstreamnt
atgaaaggattcaagctctcctgcactgccagtaactccaaccgcagcacgccggcctgc
tcgcccatcctccggaagcggtctcgctcgccaaccccgcagaaccaggacggagacacc
atggtggagaagggctcagatcactcctcggacaagtccccgtccacaccggagcagggc
gtgcagcgcagctgctcctcccagtccggccggagcggcggcaagaattccaagaaaagc
cagagttggtataatgtgttaagccccacctacaagcagagaaatgaagacttcagaaag
ctctttaagcagcttccagacacggagcgcctcattgttgattactcatgtgcactccaa
agagacattctccttcagggccgactctacctctctgaaaattggatctgcttctacagc
aacatcttccgctgggaaactctgctgacagtccgtttgaaagacatctgttccatgact
aaagaaaaaacagctcgcctcattcccaatgccatccaagtttgcactgattcagaaaag
cacttcttcacttcgtttggggcccgggataggacatatatgatgatgttccggctctgg
cagaatgctctccttgaaaagcctctgtgtcccaaggagctctggcactttgttcaccag
tgctatgggaacgaattgggcctgaccagtgatgacgaggactacgtgccccctgacgac
gacttcaacacaatgggatactgtgaagagatccctgtggaagagaatgaagtgaatgac
agctcatccaagagcagcatagagaccaagccagatgccagtccacagctgcccaagaaa
tccatcaccaacagcacactaacatccacagggagcagtgaggcccccgtctcgtttgat
gggctgcccctggaggaagaggcgctggagggagacgggtccctggaaaaggagctcgcc
attgacaacatcatgggggagaagattgagatgatcgctcctgtgaactccccttcactg
gacttcaatgacaatgaggacatccccactgagctcagtgactcttccgacacacacgat
gaaggagaggtccaggccttctatgaggacctgagtggccggcagtacgtgaatgaagtc
ttcaacttcagcgtggacaagctctatgacctcctcttcaccaactcgcccttccagcgg
gatttcatggagcagcggcgcttctctgatatcatcttccatccatggaaaaaggaggag
aatggaaaccagagccgagtgattctttacaccatcacccttaccaaccctctggctccc
aaaactgccactgtcagggagacacagaccatgtacaaggcgagccaggagagtgaatgt
tacgtgatagatgccgaagtcctcacccacgacgtgccctaccatgactacttctacaca
atcaatcgctacacgctcacccgtgtggctcggaacaagagccgactcagggtctccaca
gagctgcgctatcgaaaacagccctgggggttagtgaaaacgttcatcgagaagaacttc
tggagtgggctggaggactacttccgccatttagagagcgagctggccaaaacggagagc
acttatttggctgagatgcacagacaatctcccaaagagaaggccagcaagactacaacg
gtgcggaggaggaagcgtccccatgcccacctgcgagtccctcacctggaagaggtgatg
agcccggtcaccacgcccacagatgaggatgtgggccacaggatcaaacatgtggcaggt
tccacacagacgcggcatatcccggaggacacccccaacggtttccacctgcagagcgtg
tccaagctgctgctggttatcagctgtgtgatctgtttcagtctggtgctgctggtcatc
cttaacatgatgctcttctacaaactctggatgttggaatacaccacgcagaccctcact
gcctggcagggtctaaggctccaagaaaggttaccccagtctcagacagaatgggcccag
ctcttagagtcccaacaaaagtaccacgatactgagctccaaaaatggagggaaatcatc
aaatcctcagtgatgctccttgaccagatgaaggactcgctcatcaaccttcagaacggc
atcaggtcccgcgactacacgtcggaaagtgaagaaaagaggaatcgctatcattga

DBGET integrated database retrieval system