KEGG   Homo sapiens (human): 57488Help
Entry
57488             CDS       T01001                                 

Gene name
ESYT2, CHR2SYT, E-Syt2, FAM62B
Definition
(RefSeq) extended synaptotagmin 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SMP_LBD C2 NT-C2
Motif
Other DBs
NCBI-GeneID: 57488
NCBI-ProteinID: NP_065779
OMIM: 616691
HGNC: 22211
Ensembl: ENSG00000117868
Vega: OTTHUMG00000151436
Pharos: A0FGR8(Tbio)
UniProt: A0FGR8
Structure
PDB: 

Position
7q36.3
AA seq 845 aa AA seqDB search
MSGARGEGPEAGAGGAGGRAAPENPGGVLSVELPGLLAQLARSFALLLPVYALGYLGLSF
SWVLLALALLAWCRRSRGLKALRLCRALALLEDEERVVRLGVRACDLPAWVHFPDTERAE
WLNKTVKHMWPFICQFIEKLFRETIEPAVRGANTHLSTFSFTKVDVGQQPLRINGVKVYT
ENVDKRQIILDLQISFVGNCEIDLEIKRYFCRAGVKSIQIHGTMRVILEPLIGDMPLVGA
LSIFFLRKPLLEINWTGLTNLLDVPGLNGLSDTIILDIISNYLVLPNRITVPLVSEVQIA
QLRFPVPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYGIIRVGNQIFQSRVIKENLSP
KWNEVYEALVYEHPGQELEIELFDEDPDKDDFLGSLMIDLIEVEKERLLDEWFTLDEVPK
GKLHLRLEWLTLMPNASNLDKVLTDIKADKDQANDGLSSALLILYLDSARNLPSGKKISS
NPNPVVQMSVGHKAQESKIRYKTNEPVWEENFTFFIHNPKRQDLEVEVRDEQHQCSLGNL
KVPLSQLLTSEDMTVSQRFQLSNSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPS
VSKEGRKTSIKSHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEKAQPPEAGPQGLHDLGRS
SSSLLASPGHISVKEPTPSIASDISLPIATQELRQRLRQLENGTTLGQSPLGQIQLTIRH
SSQRNKLIVVVHACRNLIAFSEDGSDPYVRMYLLPDKRRSGRRKTHVSKKTLNPVFDQSF
DFSVSLPEVQRRTLDVAVKNSGGFLSKDKGLLGKVLVALASEELAKGWTQWYDLTEDGTR
PQAMT
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgcccggggcgagggcccggaggcgggcgccggcggggctgggggccgcgcg
gcgcctgagaaccccgggggcgtgctgagcgtggagctgcccgggctgctggcgcagctg
gcgcggagcttcgcgctgctgctgcccgtgtacgcgctgggctacctggggctcagcttc
agctgggttctcctcgcgctcgcgctgctcgcctggtgtcgccgcagccgcggcctcaag
gccctgcgcctgtgccgcgcgctggcgctgctggaagacgaggagcgcgtcgtgcgcctg
ggggtgcgcgcctgcgacctgcccgcctgggttcattttccagacactgaaagagcagaa
tggctaaataagactgtaaaacacatgtggcctttcatttgccaatttatagagaagttg
tttcgagaaactatagaaccagccgtgcggggagcaaacacccaccttagcacctttagt
ttcacgaaggtcgacgtgggccagcagcccctcaggatcaatggtgttaaggtatacact
gaaaatgtagacaaaaggcaaattattttggaccttcagattagttttgtaggaaattgt
gagattgatttggagatcaaacgatatttttgtagagctggtgtgaaaagtatccagatt
catggtaccatgcgggtgatcctggaaccgttgattggagatatgcccttagttggagct
ttgtctatcttcttccttaggaaaccacttttagaaattaactggacaggactgacgaat
cttctggatgtccctggattgaatggtttatcagatactatcattttggatataatatca
aactatctggtgcttcccaatcgaatcaccgttccacttgtcagtgaagttcaaatagct
cagttgcggtttcctgtaccaaagggtgttctaaggatacattttattgaagctcaggat
cttcaggggaaagacacttaccttaagggacttgtcaagggaaagtcagacccctatgga
atcattagagttggcaaccaaatcttccaaagcagagtcatcaaggagaacctcagtcca
aagtggaatgaagtctatgaggctttagtgtatgaacatcctggacaagaattagagatt
gagctctttgatgaagacccagacaaggatgactttttaggaagtcttatgattgacctc
attgaagttgaaaaggagcgccttttagatgaatggttcactctggacgaggttcccaag
gggaagctacacttgagactggagtggctcacgttaatgccaaatgcgtcaaacctcgac
aaggtgctaacagacatcaaagctgacaaagaccaagccaacgatggtctttcctctgca
ttgctgatcttgtacttggattcagcaaggaaccttccgtcagggaagaaaataagcagc
aacccaaatcctgttgtccagatgtcagttgggcacaaggcccaggagagcaagattcga
tacaaaaccaatgaacctgtgtgggaggaaaacttcactttcttcattcacaatcccaag
cgccaggaccttgaagttgaggtcagagacgagcagcaccagtgttccctggggaacctg
aaggtccccctcagccagctgctcaccagtgaggacatgactgtgagccagcgcttccag
ctcagtaactcgggtccaaacagcaccatcaagatgaagattgccctgcgggtgctccat
ctcgaaaagcgagaaaggcctccagaccaccaacactcagctcaagtcaaacgtccctct
gtgtccaaagaggggaggaaaacatccatcaaatctcatatgtctgggtctccaggccct
ggtggcagcaacacagctccatccacaccagtcattgggggcagtgataagcctggtatg
gaagaaaaggcccagccccctgaggccggccctcaggggctgcacgacctgggcagaagc
tcctccagcctcctggcctccccaggccacatctcagtcaaggagccgacccccagcatc
gcctcggacatctcgctgcccatcgccacccaggagctgcggcaaaggctgaggcagctg
gaaaacgggacgaccctgggacagtctccactggggcagatccagctgaccatccggcac
agctcgcagagaaacaagcttatcgtggtcgtgcatgcctgcagaaacctcattgccttc
tctgaagacggctctgacccctatgtccgcatgtatttattaccagacaagaggcggtca
ggaaggaggaaaacacacgtgtcaaagaaaacattaaatccagtgtttgatcaaagcttt
gatttcagtgtttcgttaccagaagtgcagaggagaacgctcgacgttgccgtgaagaac
agtggcggcttcctgtccaaagacaaagggctccttggcaaagtattggttgctctggca
tctgaagaacttgccaaaggctggacccagtggtatgacctcacggaagatgggacgagg
cctcaggcgatgacatag

DBGET integrated database retrieval system