KEGG   Homo sapiens (human): 57489
Entry
57489             CDS       T01001                                 
Symbol
ODF2L
Name
(RefSeq) outer dense fiber of sperm tails 2 like
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Nuf2_DHR10-like CooT
Other DBs
NCBI-GeneID: 57489
NCBI-ProteinID: NP_001007023
HGNC: 29225
Ensembl: ENSG00000122417
Pharos: Q9ULJ1(Tdark)
UniProt: Q9ULJ1
Position
1:complement(86346837..86396323)
AA seq 636 aa
MEKAVNDGSHSEELFCHLKTISEKEDLPRCTSESHLSCLKQDILNEKTELEATLKEAELV
THSVELLLPLFKDTIEKINFENANLSALNLKISEQKEILIKELDTFKSVKLALEHLLRKR
DYKQTGDNLSSMLLENLTDNESENTNLKKKVFEKEAHIQELSCLFQSEKANTLKANRFSQ
SVKVVHERLQIQIHKREAENDKLKEYVKSLETKIAKWNLQSRMNKNEAIVMKEASRQKTV
ALKKASKVYKQRLDHFTGAIEKLTSQIRDQEAKLSETISASNAWKSHYEKIVIEKTELEV
QIETMKKQIINLLEDLKKMEDHGKNSCEEILRKVHSIEYENETLNLENTKLKLRFPCRIT
ESKNMNILIVLDMLCYISSEKTTLAALKDEVVSVENELSELQEVEKKQKTLIEMYKTQVQ
KLQEAAEIVKSRCENLLHKNNQITKTKNKNVEKMRGQMESHLKELERVCDSLTAAERRLH
ECQESLQCCKGKCADQEHTIRELQGQVDGNHNLLTKLSLEEENCLIQLKCENLQQKLEQM
DAENKELEKKLANQEECLKHSNLKFKEKSAEYTALARQLEAALEEGRQKVAEEIEKMSSR
ESALQIKILDLETELRKKNEEQNQLVCKMNSDPETP
NT seq 1911 nt   +upstreamnt  +downstreamnt
atggagaaggctgtaaatgatggaagtcattcagaagaactcttttgccatcttaaaact
atatcagagaaagaagatttaccacggtgtaccagtgaaagtcatctcagctgcctgaag
caggacattctaaatgaaaagactgaattggaagcaacacttaaggaagcggagttggta
actcattctgtagaattgcttttgccactatttaaggacaccattgaaaagattaatttt
gaaaatgcgaatctttctgcattgaatttgaagatttctgaacagaaggaaatattaata
aaagaattagacaccttcaaaagtgtaaaactagctttagaacatcttcttagaaagaga
gactacaaacaaacaggagacaatttatccagcatgttgctagaaaatctaactgataat
gaaagtgaaaatactaatcttaagaagaaggtatttgaaaaggaggcccatatccaagaa
ctttcttgtttgtttcagagtgaaaaggcaaatactttgaaagcaaaccgtttttcccaa
tcagtaaaagtagtacatgaacgactacagatccaaattcataaaagggaagccgagaac
gataagttgaaagaatatgtaaagagcttagaaaccaagatagccaagtggaacctgcaa
tcaagaatgaataagaatgaggctatagtgatgaaagaagcaagtaggcaaaaaactgta
gctttaaaaaaggcatctaaagtttacaaacaaaggcttgaccattttacaggagctatt
gaaaagcttacttcccaaattagagatcaggaagccaagttgtctgaaacaatttcagct
tccaatgcctggaaaagtcattatgagaaaattgtgatagaaaaaaccgaattggaagta
cagattgaaacaatgaaaaagcaaatcattaatcttttggaagatctgaagaaaatggaa
gaccatggaaaaaattcatgtgaagaaattcttagaaaagttcactcaattgaatatgaa
aatgaaactctgaatcttgagaatacaaaattaaagcttagattcccatgtagaattact
gagtcaaagaatatgaacattttgattgttcttgatatgctttgctacatttcttctgaa
aagactacacttgctgctttgaaggatgaagttgtatctgttgaaaatgaactctcagaa
ttgcaagaagtagaaaaaaaacagaaaacccttattgaaatgtataaaactcaggtacaa
aagttgcaagaagcagctgaaatagtaaaaagcagatgtgaaaatttgctacataaaaat
aaccaaataacaaaaaccaaaaataaaaatgtagagaagatgagaggccagatggagtct
catctgaaggagttagagcgtgtctgcgattccttgacggcggcggaacggaggcttcac
gagtgtcaggagagtctgcagtgctgcaaggggaagtgtgcagaccaggaacacaccatt
agggagcttcagggccaggttgatggaaatcacaatcttctgacaaagctttctctggaa
gaggaaaactgtcttattcagctgaagtgtgaaaaccttcaacaaaaattagaacagatg
gacgcagaaaataaagagcttgagaagaagctggcaaaccaagaagaatgtcttaagcac
agcaatcttaagtttaaagagaaatctgcagagtatacagcattggccagacaactggaa
gctgctttagaagaaggaagacaaaaggttgctgaagaaatagagaaaatgtcatctaga
gagagtgctttacaaattaaaatattagatctggaaactgagcttagaaagaaaaatgaa
gaacaaaatcaacttgtttgcaaaatgaacagtgatccagagactccatga

DBGET integrated database retrieval system