KEGG   Homo sapiens (human): 57497Help
Entry
57497             CDS       T01001                                 

Gene name
LRFN2, FIGLER2, KIAA1246, SALM1
Definition
(RefSeq) leucine rich repeat and fibronectin type III domain containing 2
  KO
K16355  leucine-rich repeat and fibronectin type-III domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    57497 (LRFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 I-set Ig_3 LRR_4 ig fn3 LRR_9 LRR_5 Ig_2
Motif
Other DBs
NCBI-GeneID: 57497
NCBI-ProteinID: NP_065788
OMIM: 612808
HGNC: 21226
Ensembl: ENSG00000156564
Vega: OTTHUMG00000014662
Pharos: Q9ULH4(Tbio)
UniProt: Q9ULH4
Position
6p21.2-p21.1
AA seq 789 aa AA seqDB search
METLLGGLLAFGMAFAVVDACPKYCVCQNLSESLGTLCPSKGLLFVPPDIDRRTVELRLG
GNFIIHISRQDFANMTGLVDLTLSRNTISHIQPFSFLDLESLRSLHLDSNRLPSLGEDTL
RGLVNLQHLIVNNNQLGGIADEAFEDFLLTLEDLDLSYNNLHGLPWDSVRRMVNLHQLSL
DHNLLDHIAEGTFADLQKLARLDLTSNRLQKLPPDPIFARSQASALTATPFAPPLSFSFG
GNPLHCNCELLWLRRLERDDDLETCGSPGGLKGRYFWHVREEEFVCEPPLITQHTHKLLV
LEGQAATLKCKAIGDPSPLIHWVAPDDRLVGNSSRTAVYDNGTLDIFITTSQDSGAFTCI
AANAAGEATAMVEVSIVQLPHLSNSTSRTAPPKSRLSDITGSSKTSRGGGGSGGGEPPKS
PPERAVLVSEVTTTSALVKWSVSKSAPRVKMYQLQYNCSDDEVLIYRMIPASNKAFVVNN
LVSGTGYDLCVLAMWDDTATTLTATNIVGCAQFFTKADYPQCQSMHSQILGGTMILVIGG
IIVATLLVFIVILMVRYKVCNHEAPSKMAAAVSNVYSQTNGAQPPPPSSAPAGAPPQGPP
KVVVRNELLDFTASLARASDSSSSSSLGSGEAAGLGRAPWRIPPSAPRPKPSLDRLMGAF
ASLDLKSQRKEELLDSRTPAGRGAGTSARGHHSDREPLLGPPAARARSLLPLPLEGKAKR
SHSFDMGDFAAAAAGGVVPGGYSPPRKVSNIWTKRSLSVNGMLLPFEESDLVGARGTFGS
SEWVMESTV
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atggagaccctgcttggtggcctgctagcgtttggcatggcgtttgccgtggtcgacgcc
tgccccaagtactgtgtctgccagaatctgtctgagtcactggggaccctgtgcccctcc
aaggggctgctctttgtaccccctgatattgaccggcggacagtggagctgcgcctgggc
ggcaacttcatcatccacatcagccgccaggactttgccaacatgacggggctggtggac
ctgaccctgtccaggaacaccatcagccacatccagcccttttcctttctggacctcgag
agcctccgctccctgcatcttgacagcaatcggctgccaagccttggggaggacaccctc
cggggcctggtcaacctgcagcaccttatcgtgaacaacaaccagctgggcggcatcgca
gatgaggcttttgaggacttcctgctgacattggaggatctggacctctcctacaacaac
ctccatggcctgccgtgggactccgtgcgacgcatggtcaacctccaccagctgagcctg
gaccacaacctgctggatcacatcgccgagggcacctttgcagacctgcagaaactggcc
cgcctggatctcacctccaatcggctgcagaagctgccccctgatcccatctttgcccgc
tcccaggcttcggctttgacagccacaccctttgccccacccttgtcctttagttttggg
ggtaacccacttcactgcaattgtgagcttctctggctgcggaggctcgagcgggacgat
gacctggaaacctgtggctccccagggggcctcaagggtcgctacttctggcatgtgcgt
gaggaggagtttgtgtgcgagccgcctctcatcacccagcacacacacaagttgctggtt
ctggagggccaggcggccacactcaagtgcaaagccattggggaccccagcccccttatc
cactgggtagcccccgatgaccgcctggtagggaactcctcaaggaccgctgtctatgac
aatggcaccctggacatcttcatcaccacatctcaggacagtggtgccttcacctgcatt
gctgccaatgctgccggagaggccacggccatggtggaggtctccatcgtccagctgcca
cacctcagcaacagcaccagccgcactgcaccccccaagtcccgcctctcagacatcact
ggctccagcaagaccagccggggaggtggaggcagtgggggcggagagcctcccaaaagc
cccccggaacgggctgtgcttgtgtctgaagtgaccaccacctcggccctggtcaagtgg
tctgtcagcaagtcagcaccccgggtgaagatgtaccagctgcagtacaactgctctgac
gatgaggtactgatttacaggatgatcccagcctccaacaaggccttcgtggtcaacaac
ctggtgtcagggactggctacgacttgtgtgtgctggccatgtgggatgacacagccacg
acactcacggccaccaacatcgtgggctgcgcccagttcttcaccaaggctgactacccg
cagtgccagtccatgcacagccagattctgggcggcaccatgatcctggtcatcgggggc
atcatcgtggccacgctgctggtcttcatcgtcatcctcatggtgcgctacaaggtctgc
aaccacgaggcccccagcaagatggcagcggccgtgagcaatgtgtactcgcagaccaac
ggcgcccagccaccgcctccaagcagcgcaccagccggggccccgccgcagggcccgccg
aaggtggtggtgcgcaacgagctcctggacttcaccgccagcctggcccgcgccagtgac
tcctcttcctccagctccctgggcagtggggaggctgcggggctgggacgggccccctgg
aggatcccaccctccgccccgcgccccaagcccagccttgaccgcctgatgggggccttc
gcctccctggacctcaagagtcagagaaaggaggagctgctggactccaggactccagcc
gggagaggggctgggacgtcggcccggggccaccactcggaccgagagccactgctgggg
ccccctgcggcccgggccaggagcctgctccccttgccgttggagggcaaggccaaacgc
agccactccttcgacatgggggactttgctgctgcggcggcgggaggggtcgtgccgggc
ggctacagtcctcctcggaaggtctcgaacatctggacgaagcgcagcctctctgtcaac
ggcatgctcttgccctttgaggagagtgacctggtgggggcccgggggacttttggcagc
tccgaatgggtgatggagagcacggtctag

DBGET integrated database retrieval system