KEGG   Homo sapiens (human): 575Help
Entry
575               CDS       T01001                                 

Gene name
ADGRB1, BAI1, GDAIF
Definition
(RefSeq) adhesion G protein-coupled receptor B1
  KO
K04596  adhesion G protein-coupled receptor B1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    575 (ADGRB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    575 (ADGRB1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    575 (ADGRB1)
Peptidases [BR:hsa01002]
 Mixed Peptidases
  Family P2
   575 (ADGRB1)
G protein-coupled receptors [BR:hsa04030]
 Adhesion receptor family
  Brain-specific angiogenesis inhibitor (BAI)
   575 (ADGRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 TSP_1 GAIN GPS HRM
Motif
Other DBs
NCBI-GeneID: 575
NCBI-ProteinID: NP_001693
OMIM: 602682
HGNC: 943
Ensembl: ENSG00000181790
Vega: OTTHUMG00000164732
Pharos: O14514(Tbio)
UniProt: O14514
Position
8q24.3
AA seq 1584 aa AA seqDB search
MRGQAAAPGPVWILAPLLLLLLLLGRRARAAAGADAGPGPEPCATLVQGKFFGYFSAAAV
FPANASRCSWTLRNPDPRRYTLYMKVAKAPVPCSGPGRVRTYQFDSFLESTRTYLGVESF
DEVLRLCDPSAPLAFLQASKQFLQMRRQQPPQHDGLRPRAGPPGPTDDFSVEYLVVGNRN
PSRAACQMLCRWLDACLAGSRSSHPCGIMQTPCACLGGEAGGPAAGPLAPRGDVCLRDAV
AGGPENCLTSLTQDRGGHGATGGWKLWSLWGECTRDCGGGLQTRTRTCLPAPGVEGGGCE
GVLEEGRQCNREACGPAGRTSSRSQSLRSTDARRREELGDELQQFGFPAPQTGDPAAEEW
SPWSVCSSTCGEGWQTRTRFCVSSSYSTQCSGPLREQRLCNNSAVCPVHGAWDEWSPWSL
CSSTCGRGFRDRTRTCRPPQFGGNPCEGPEKQTKFCNIALCPGRAVDGNWNEWSSWSACS
ASCSQGRQQRTRECNGPSYGGAECQGHWVETRDCFLQQCPVDGKWQAWASWGSCSVTCGA
GSQRRERVCSGPFFGGAACQGPQDEYRQCGTQRCPEPHEICDEDNFGAVIWKETPAGEVA
AVRCPRNATGLILRRCELDEEGIAYWEPPTYIRCVSIDYRNIQMMTREHLAKAQRGLPGE
GVSEVIQTLVEISQDGTSYSGDLLSTIDVLRNMTEIFRRAYYSPTPGDVQNFVQILSNLL
AEENRDKWEEAQLAGPNAKELFRLVEDFVDVIGFRMKDLRDAYQVTDNLVLSIHKLPASG
ATDISFPMKGWRATGDWAKVPEDRVTVSKSVFSTGLTEADEASVFVVGTVLYRNLGSFLA
LQRNTTVLNSKVISVTVKPPPRSLRTPLEIEFAHMYNGTTNQTCILWDETDVPSSSAPPQ
LGPWSWRGCRTVPLDALRTRCLCDRLSTFAILAQLSADANMEKATLPSVTLIVGCGVSSL
TLLMLVIIYVSVWRYIRSERSVILINFCLSIISSNALILIGQTQTRNKVVCTLVAAFLHF
FFLSSFCWVLTEAWQSYMAVTGHLRNRLIRKRFLCLGWGLPALVVAISVGFTKAKGYSTM
NYCWLSLEGGLLYAFVGPAAAVVLVNMVIGILVFNKLVSKDGITDKKLKERAGASLWSSC
VVLPLLALTWMSAVLAVTDRRSALFQILFAVFDSLEGFVIVMVHCILRREVQDAVKCRVV
DRQEEGNGDSGGSFQNGHAQLMTDFEKDVDLACRSVLNKDIAACRTATITGTLKRPSLPE
EEKLKLAHAKGPPTNFNSLPANVSKLHLHGSPRYPGGPLPDFPNHSLTLKRDKAPKSSFV
GDGDIFKKLDSELSRAQEKALDTSYVILPTATATLRPKPKEEPKYSIHIDQMPQTRLIHL
STAPEASLPARSPPSRQPPSGGPPEAPPAQPPPPPPPPPPPPQQPLPPPPNLEPAPPSLG
DPGEPAAHPGPSTGPSTKNENVATLSVSSLERRKSRYAELDFEKIMHTRKRHQDMFQDLN
RKLQHAAEKDKEVLGPDSKPEKQQTPNKRPWESLRKAHGTPTWVKKELEPLQPSPLELRS
VEWERSGATIPLVGQDIIDLQTEV
NT seq 4755 nt NT seq  +upstreamnt  +downstreamnt
atgaggggccaggccgccgccccgggccccgtctggatcctcgccccgctgctactgctg
ctgctgctgctgggacgccgcgcgcgggcggccgccggagcagacgcggggcccgggccc
gagccgtgcgccacgctggtgcagggaaagttcttcggctacttctccgcggccgccgtg
ttcccggccaacgcctcgcgctgctcctggacgctacgcaacccggacccgcggcgctac
actctctacatgaaggtggccaaggcgcccgtgccctgcagcggccccggccgcgtgcgc
acctaccagttcgactccttcctcgagtccacgcgcacctacctgggcgtggagagcttc
gacgaggtgctgcggctctgcgacccctccgcacccctggccttcctgcaggccagcaag
cagttcctgcagatgcggcgccagcagccgccccagcacgacgggctccggccccgggcc
gggccgccgggccccaccgacgacttctccgtggagtacctggtggtggggaaccgcaac
cccagccgtgccgcctgccagatgctgtgccgctggctggacgcgtgtctggccggtagt
cgcagctcgcacccctgcgggatcatgcagaccccctgcgcctgcctgggcggcgaggcg
ggcggccctgccgcgggacccctggccccccgcggggatgtctgcttgagagatgcggtg
gctggtggccctgaaaactgcctcaccagcctgacccaggaccggggcgggcacggcgcc
acaggcggctggaagctgtggtccctgtggggcgaatgcacgcgggactgcgggggaggc
ctccagacgcggacgcgcacctgcctgcccgcgccgggcgtggagggcggcggctgcgag
ggggtgctggaggagggtcgccagtgcaaccgcgaggcctgcggccccgctgggcgcacc
agctcccggagccagtccctgcggtccacagatgcccggcggcgcgaggagctgggggac
gagctgcagcagtttgggttcccagccccccagaccggtgacccagcagccgaggagtgg
tccccgtggagcgtgtgctccagcacctgcggcgagggctggcagacccgcacgcgcttc
tgcgtgtcctcctcctacagcacgcagtgcagcggacccctgcgcgagcagcggctgtgc
aacaactctgccgtgtgcccagtgcatggtgcctgggatgagtggtcgccctggagcctc
tgctccagcacctgtggccgtggctttcgggatcgcacgcgcacctgcaggcccccccag
tttgggggcaacccctgtgagggccctgagaagcaaaccaagttctgcaacattgccctg
tgccctggccgggcagtggatggaaactggaatgagtggtcgagctggagcgcctgctcc
gccagctgctcccagggccgacagcagcgcacgcgtgaatgcaacgggccttcctacggg
ggtgcggagtgccagggccactgggtggagacccgagactgcttcctgcagcagtgccca
gtggatggcaagtggcaggcctgggcgtcatggggcagttgcagcgtcacgtgtggggct
ggcagccagcgacgggagcgtgtctgctctgggcccttcttcgggggagcagcctgccag
ggcccccaggatgagtaccggcagtgcggcacccagcggtgtcccgagccccatgagatc
tgtgatgaggacaactttggtgctgtgatctggaaggagaccccagcgggagaggtggct
gctgtccggtgtccccgcaacgccacaggactcatcctgcgacggtgtgagctggacgag
gaaggcatcgcctactgggagccccccacctacatccgctgtgtttccattgactacaga
aacatccagatgatgacccgggagcacctggccaaggctcagcgagggctgcctggggag
ggggtctcggaggtcatccagacactggtggagatctctcaggacgggaccagctacagt
ggggacctgctgtccaccatcgatgtcctgaggaacatgacagagattttccggagagcg
tactacagccccacccctggggacgtacagaactttgtccagatccttagcaacctgttg
gcagaggagaatcgggacaagtgggaggaggcccagctggcgggccccaacgccaaggag
ctgttccggctggtggaggactttgtggacgtcatcggcttccgcatgaaggacctgagg
gatgcataccaggtgacagacaacctggttctcagcatccataagctcccagccagcgga
gccactgacatcagcttccccatgaagggctggcgggccacgggtgactgggccaaggtg
ccagaggacagggtcactgtgtccaagagtgtcttctccacggggctgacagaggccgat
gaagcatccgtgtttgtggtgggcaccgtgctctacaggaacctgggcagcttcctggcc
ctgcagaggaacacgaccgtcctgaattctaaggtgatctccgtgactgtgaaacccccg
cctcgctccctgcgcacacccttggagatcgagtttgcccacatgtataatggcaccacc
aaccagacctgtatcctgtgggatgagacggatgtaccctcctcctccgcccccccgcag
ctcgggccctggtcgtggcgcggctgccgcacggtgcccctcgacgccctccggacgcgc
tgcctctgtgaccggctctccaccttcgccatcttagcccagctcagcgccgacgcgaac
atggagaaggcgactctgccgtcggtgacgctcatcgtgggctgtggcgtgtcctctctc
accctgctcatgctggtcatcatctacgtgtccgtgtggaggtacattcgctcagagcgt
tctgtcatcctcatcaacttctgcctgtccatcatctcctccaatgccctcatcctcatc
gggcagacccagacccgcaacaaggtggtgtgcacgctggtggccgccttcctgcacttc
ttcttcctgtcctccttctgctgggtgctcaccgaggcctggcagtcctacatggcggtg
acgggccacctccggaaccgcctcatccgcaagcgcttcctctgcctgggctgggggctc
cctgcactggttgtggccatttctgtgggattcaccaaggccaaagggtacagcaccatg
aactactgctggctctccctggaggggggactgctctatgccttcgtgggacctgccgct
gccgttgtgctggtgaacatggtcattgggatcctggtgttcaacaagctcgtgtccaaa
gacggcatcacggacaagaagctgaaggagcgggcaggggcctccctgtggagctcctgc
gtggtgctgccgctgctggcgctgacctggatgtcggctgtgctcgccgtcaccgaccgc
cgctccgccctcttccagatcctcttcgctgtcttcgactcgctggagggcttcgtcatc
gtcatggtgcactgtatcctccgtagagaggtccaggacgctgtgaaatgccgtgtggtt
gaccggcaggaggagggcaacggggactcagggggctccttccagaacggccacgcccag
ctcatgaccgacttcgagaaggacgtggatctggcctgtagatcagtgctgaacaaggac
atcgcggcctgccgcactgccaccatcacgggcacactgaagcggccgtctctgcccgag
gaggagaagctgaagctggcccatgccaaggggccgcccaccaatttcaacagcctgccg
gccaacgtgtccaagctgcacctgcacggctcaccccgctatcccggcgggcccctgccc
gacttccccaaccactcactgaccctcaagagggacaaggcgcccaagtcctccttcgtc
ggtgacggggacatcttcaagaagctggactcggagctgagccgggcccaggagaaggct
ctggacacgagctacgtgatcctgcccacggccacggccacgctgcggcccaagcccaag
gaggagcccaagtacagcatccacattgaccagatgccgcagacccgcctcatccacctc
agcacggcccccgaggccagcctccccgcccgcagcccgccctcccgccagccccccagc
ggcgggccccccgaggcaccccctgcccagcccccaccgcctccgcccccaccgccacca
cctccccagcagcccctgcccccaccgcccaatctggagccggcaccccccagcctgggg
gatcccggggagcctgccgcccatccgggacccagcacggggcccagcaccaagaacgag
aatgtcgccaccttgtctgtgagctccctggagcggcggaagtcgcggtatgcagaactg
gactttgagaagatcatgcacacccggaagcggcaccaagacatgttccaggacctgaac
cggaagctgcagcacgcagcggagaaggacaaggaggtgctggggccggacagcaagccg
gaaaagcagcagacgcccaacaagaggccctgggagagcctccggaaagcccacgggacg
cccacgtgggtgaagaaggagctggagccgctgcagccgtcgccgctggagcttcgcagc
gtggagtgggagaggtcgggcgccacgatcccgctggtgggccaggacatcatcgacctc
cagaccgaggtctga

DBGET integrated database retrieval system