KEGG   Homo sapiens (human): 57502Help
Entry
57502             CDS       T01001                                 

Gene name
NLGN4X, ASPGX2, AUTSX2, HLNX, HNL4X, NLGN4
Definition
(RefSeq) neuroligin 4 X-linked
  KO
K07378  neuroligin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
Disease
H00480  Non-syndromic X-linked mental retardation
H01882  Asperger syndrome
H02111  Autism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    57502 (NLGN4X)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    57502 (NLGN4X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 57502
NCBI-ProteinID: NP_001269074
OMIM: 300427
HGNC: 14287
Ensembl: ENSG00000146938
Vega: OTTHUMG00000021093
Pharos: Q8N0W4(Tbio)
UniProt: Q8N0W4 A0A024RBV0 B3KP11
Structure
PDB: 

Position
Xp22.32-p22.31
AA seq 816 aa AA seqDB search
MSRPQGLLWLPLLFTPVCVMLNSNVLLWLTALAIKFTLIDSQAQYPVVNTNYGKIRGLRT
PLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGIRNTTQFAAVCPQHLDERSLL
HDMLPIWFTANLDTLMTYVQDQNEDCLYLNIYVPTEDDIHDQNSKKPVMVYIHGGSYMEG
TGNMIDGSILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGA
FGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRIL
ADKVGCNMLDTTDMVECLRNKNYKELIQQTITPATYHIAFGPVIDGDVIPDDPQILMEQG
EFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETI
KFMYTDWADKENPETRRKTLVALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEM
KPSWADSAHGDEVPYVFGIPMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPV
PQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNL
NEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKHSKDPHKTGPED
TTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYKKDKRRHETHRRPSPQRNTTND
IAHIQNEEIMSLQMKQLEHDHECESLQAHDTLRLTCPPDYTLTLRRSPDDIPLMTPNTIT
MIPNTLTGMQPLHTFNTFSGGQNSTNLPHGHSTTRV
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgtcacggccccagggactgctatggcttcctttgttgttcaccccggtctgcgtcatg
ttaaactccaatgtcctcctgtggttaactgctcttgccatcaagttcaccctcattgac
agccaagcacagtatccagttgtcaacacaaattatggcaaaatccggggcctaagaaca
ccgttacccaatgagatcttgggtccagtggagcagtacttaggggtcccctatgcctca
ccccccactggagagaggcggtttcagcccccagaacccccgtcctcctggactggcatc
cgaaatactactcagtttgctgctgtgtgcccccagcacctggatgagagatccttactg
catgacatgctgcccatctggtttaccgccaatttggatactttgatgacctatgttcaa
gatcaaaatgaagactgcctttacttaaacatctacgtgcccacggaagatgatattcat
gatcagaacagtaagaagcccgtcatggtctatatccatgggggatcttacatggagggc
accggcaacatgattgacggcagcattttggcaagctacggaaacgtcatcgtgatcacc
attaactaccgtctgggaatactagggtttttaagtaccggtgaccaggcagcaaaaggc
aactatgggctcctggatcagattcaagcactgcggtggattgaggagaatgtgggagcc
tttggcggggaccccaagagagtgaccatctttggctcgggggctggggcctcctgtgtc
agcctgttgaccctgtcccactactcagaaggtctcttccagaaggccatcattcagagc
ggcaccgccctgtccagctgggcagtgaactaccagccggccaagtacactcggatattg
gcagacaaggtcggctgcaacatgctggacaccacggacatggtagaatgcctgcggaac
aagaactacaaggagctcatccagcagaccatcaccccggccacctaccacatagccttc
gggccggtgatcgacggcgacgtcatcccagacgacccccagatcctgatggagcaaggc
gagttcctcaactacgacatcatgctgggcgtcaaccaaggggaaggcctgaagttcgtg
gacggcatcgtggataacgaggacggtgtgacgcccaacgactttgacttctccgtgtcc
aacttcgtggacaacctttacggctaccctgaagggaaagacactttgcgggagactatc
aagttcatgtacacagactgggccgataaggaaaacccggagacgcggcggaaaaccctg
gtggctctctttactgaccaccagtgggtggcccccgccgtggccaccgccgacctgcac
gcgcagtacggctcccccacctacttctatgccttctatcatcactgccaaagcgaaatg
aagcccagctgggcagattcggcccatggtgatgaggtcccctatgtcttcggcatcccc
atgatcggtcccaccgagctcttcagttgtaacttttccaagaacgacgtcatgctcagc
gccgtggtcatgacctactggacgaacttcgccaaaactggtgatccaaatcaaccagtt
cctcaggataccaagttcattcacacaaaacccaaccgctttgaagaagtggcctggtcc
aagtataatcccaaagaccagctctatctgcatattggcttgaaacccagagtgagagat
cactaccgggcaacgaaagtggctttctggttggaactcgttcctcatttgcacaacttg
aacgagatattccagtatgtttcaacaaccacaaaggttcctccaccagacatgacatca
tttccctatggcacccggcgatctcccgccaagatatggccaaccaccaaacgcccagca
atcactcctgccaacaatcccaaacactctaaggaccctcacaaaacagggcctgaggac
acaactgtcctcattgaaaccaaacgagattattccaccgaattaagtgtcaccattgcc
gtcggggcgtcgctcctcttcctcaacatcttagcttttgcggcgctgtactacaaaaag
gacaagaggcgccatgagactcacaggcgccccagtccccagagaaacaccacaaatgat
atcgctcacatccagaacgaagagatcatgtctctgcagatgaagcagctggaacacgat
cacgagtgtgagtcgctgcaggcacacgacacactgaggctcacctgcccgccagactac
accctcacgctgcgccggtcgccagatgacatcccacttatgacgccaaacaccatcacc
atgattccaaacacactgacggggatgcagcctttgcacacttttaacaccttcagtgga
ggacaaaacagtacaaatttaccccacggacattccaccactagagtatag

DBGET integrated database retrieval system