KEGG   Homo sapiens (human): 57504
Entry
57504             CDS       T01001                                 

Gene name
MTA3
Definition
(RefSeq) metastasis associated 1 family member 3
  KO
K11660  metastasis-associated protein MTA
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    57504 (MTA3)
   03036 Chromosome and associated proteins [BR:hsa03036]
    57504 (MTA3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    57504 (MTA3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRD complex
    57504 (MTA3)
SSDB
Motif
Pfam: BAH MTA_R1 ELM2 GATA Myb_DNA-binding Myb_DNA-bind_7
Other DBs
NCBI-GeneID: 57504
NCBI-ProteinID: NP_001317371
OMIM: 609050
HGNC: 23784
Ensembl: ENSG00000057935
Vega: OTTHUMG00000150452
Pharos: Q9BTC8(Tbio)
UniProt: Q9BTC8
Position
2p21
AA seq 594 aa
MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLAD
KHAKEIEEESETTVEADLTDKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESV
LSYLDKEDTFFYSLVYDPSLKTLLADKGEIRVGPRYQADIPEMLLEGESDEREQSKLEVK
VWDPNSPLTDRQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDT
LYRHSYDLSSAISVLVPLGGPVLCRDEMEEWSASEASLFEEALEKYGKDFNDIRQDFLPW
KSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYSKPNPNQISTSNGKPGAV
NGAVGTTFQPQNPLLGRACESCYATQSHQWYSWGPPNMQCRLCAICWLYWKKYGGLKMPT
QSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQAFFLHTTYFTKFAR
QVCKNTLRLRQAARRPFVAINYAAIRAEYADRHAELSGSPLKSKSTRKPLACIIGYLEIH
PAKKPNVIRSTPSLQTPTTKRMLTTPNHTSLSILGKRNYSHHNGLDELTCCVSD
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggcggccaacatgtaccgggtcggagattatgtctactttgagaattcctccagcaac
ccatacctaataagaaggatagaagaactcaacaagactgcaagtggcaacgtggaagca
aaagtagtatgcttttatagacgacgtgatatttccaacacacttataatgctcgcagat
aagcatgctaaagaaattgaggaagaatctgaaacaacagttgaggctgacttgaccgat
aagcagaaacatcagttgaaacatagggaactctttttgtcacgccagtatgaatctctg
cccgcaacacatatcaggggaaagtgcagtgttgcccttctgaatgagacagaatcagta
ttgtcatatcttgataaggaggataccttcttctactcattggtctatgacccctcattg
aaaacactattagctgacaaaggtgaaatcagagtgggacctagatatcaagcagacatt
ccagaaatgctgttagaaggagaatcagatgagagggaacaatcaaaattggaagttaaa
gtttgggatccaaatagcccacttacggatcgacagattgaccagtttttagttgtagca
cgtgctgttgggacattcgccagagccctggattgcagcagttctgtgaggcagcctagt
ttgcatatgagtgctgctgcagcttcccgagacatcaccttgtttcacgctatggataca
ttgtatagacacagctatgatttgagcagtgccattagtgtcttagtaccactcggagga
cctgttttatgcagagatgaaatggaggaatggtcagcctctgaagctagcttatttgaa
gaggcactggaaaaatatggcaaagacttcaatgacatacggcaagattttcttccttgg
aaatcattgactagcatcattgaatattattacatgtggaaaactactgacagatatgtg
caacagaaacgtctaaaagcagcagaagctgagagtaaactgaaacaagtatatatccca
acctacagcaaaccaaatcccaaccaaatatccactagtaatgggaagcctggtgctgtg
aatggagctgtggggaccacgttccagcctcagaatcctctcttagggagagcctgtgag
agctgctatgctacacagtctcaccagtggtattcttggggcccacctaatatgcagtgt
agattatgtgcaatttgttggctttattggaaaaaatatggaggcttgaaaatgcccacc
cagtcagaagaagagaagttatctcctagcccaactacagaggaccctcgtgttagaagt
cacgtgtcccgccaggccatgcagggaatgccagtccgaaacactgggagtccaaagtct
gcagtgaagacccgccaagctttcttccttcatactacatatttcacaaaatttgctcgt
caggtctgcaaaaataccctccggctgcggcaggcagcaagacggccgtttgttgctatt
aattatgctgccattagggcagaatatgcagacagacatgctgaactatctggaagtcca
ctgaaaagcaaaagcactaggaagcctttggcatgtatcattgggtatttagagatccat
cctgcaaagaaacctaatgtaattcgatctacaccaagcctgcaaaccccaactaccaag
cggatgctaacaactccaaatcacacatctctgagcattctggggaaaagaaactacagt
catcacaatggtctggatgaactcacgtgctgtgtgtcagactga

DBGET integrated database retrieval system