KEGG   Homo sapiens (human): 57509
Entry
57509             CDS       T01001                                 

Gene name
MTUS1, ATBP, ATIP, ATIP3, ICIS, MP44, MTSG1
Definition
(RefSeq) microtubule associated scaffold protein 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SRP19
Other DBs
NCBI-GeneID: 57509
NCBI-ProteinID: NP_001001924
OMIM: 609589
HGNC: 29789
Ensembl: ENSG00000129422
Vega: OTTHUMG00000163756
Pharos: Q9ULD2(Tbio)
UniProt: Q9ULD2
Position
8p22
AA seq 1270 aa
MTDDNSDDKIEDELQTFFTSDKDGNTHAYNPKSPPTQNSSASSVNWNSANPDDMVVDYET
DPAVVTGENISLSLQGVEVFGHEKSSSDFISKQVLDMHKDSICQCPALVGTEKPKYLQHS
CHSLEAVEGQSVEPSLPFVWKPNDNLNCAGYCDALELNQTFDMTVDKVNCTFISHHAIGK
SQSFHTAGSLPPTGRRSGSTSSLSYSTWTSSHSDKTHARETTYDRESFENPQVTPSEAQD
MTYTAFSDVVMQSEVFVSDIGNQCACSSGKVTSEYTDGSQQRLVGEKETQALTPVSDGME
VPNDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNLRETVSYCLIDDECPLMVPAFDKS
EAQVLNPEHKVTETEDTQMVSKGKDLGTQNHTSELILSSPPGQKVGSSFGLTWDANDMVI
STDKTMCMSTPVLEPTKVTFSVSPIEATEKCKKVEKGNRGLKNIPDSKEAPVNLCKPSLG
KSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAKVMSRAVLQPKDAALSKVTPRPQQTSAS
SPSSVNSRQQTVLSRTPRSDLNADKKAEILINKTHKQQFNKLITSQAVHVTTHSKNASHR
VPRTTSAVKSNQEDVDKASSSNSACETGSVSALFQKIKGILPVKMESAECLEMTYVPNID
RISPEKKGEKENGTSMEKQELKQEIMNETFEYGSLFLGSASKTTTTSGRNISKPDSCGLR
QIAAPKAKVGPPVSCLRRNSDNRNPSADRAVSPQRIRRVSSSGKPTSLKTAQSSWVNLPR
PLPKSKASLKSPALRRTGSTPSIASTHSELSTYSNNSGNAAVIKYEEKPPKPAFQNGSSG
SFYLKPLVSRAHVHLMKTPPKGPSRKNLFTALNAVEKSRQKNPRSLCIQPQTAPDALPPE
KTLELTQYKTKCENQSGFILQLKQLLACGNTKFEALTVVIQHLLSEREEALKQHKTLSQE
LVNLRGELVTASTTCEKLEKARNELQTVYEAFVQQHQAEKTERENRLKEFYTREYEKLRD
TYIEEAEKYKMQLQEQFDNLNAAHETSKLEIEASHSEKLELLKKAYEASLSEIKKGHEIE
KKSLEDLLSEKQESLEKQINDLKSENDALNEKLKSEEQKRRAREKANLKNPQIMYLEQEL
ESLKAVLEIKNEKLHQQDIKLMKMEKLVDNNTALVDKLKRFQQENEELKARMDKHMAISR
QLSTEQAVLQESLEKESKVNKRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSG
SFPSPSISPR
NT seq 3813 nt   +upstreamnt  +downstreamnt
atgactgatgataattcagatgataaaatagaagatgaattgcaaaccttctttaccagt
gataaagatggaaatacacatgcatacaacccgaaatcaccacctacacaaaactcttca
gccagcagtgtgaactggaattctgccaacccagatgacatggtggttgattatgaaact
gaccctgctgtagttactggtgaaaatatttctttaagccttcagggtgttgaagtattt
ggtcatgaaaagtcttctagtgatttcattagtaagcaggtgttagatatgcataaagat
tctatttgtcagtgtcctgcacttgtaggtactgagaagcccaaatatctgcaacacagt
tgtcattccctagaagcagttgagggccagagtgttgagccatctttgccttttgtgtgg
aagcctaatgacaatttgaactgtgcaggctactgtgatgccttggagctaaaccaaaca
tttgacatgacagtggataaagttaactgcacctttatatcacatcatgccatcggaaag
agtcagtccttccatactgctggaagcctgccaccaactggtaggagaagtggaagtaca
tcttctttatcctattccacttggacatcttcccattctgataagacgcatgcaagagaa
actacttatgatagagaaagctttgaaaaccctcaagtcacaccatcagaagcccaagac
atgacttacacagcattttctgatgtggtgatgcaaagtgaggtttttgtttcagatatt
ggaaatcagtgtgcatgttcttcaggaaaggtcaccagtgagtacacagatggatcacaa
caaagactagttggagaaaaggagacacaagcactaacaccagtttctgatggcatggaa
gtccccaatgattctgcattacaagagttcttttgtttatcccatgatgaatccaatagc
gaaccacattcacagagctcatacaggcacaaggaaatgggccaaaatctgagagagaca
gtgtcctattgtcttattgatgatgaatgccctttaatggtgccagcttttgataagagc
gaagctcaagtgctgaacccagagcataaagtcactgagactgaagacacacaaatggtc
tccaaaggaaaggatttgggaacccaaaatcatacctcagaattgattctaagtagcccg
ccaggacaaaaggtgggctcgtcatttggactgacttgggatgcaaatgatatggtcatt
agcacagacaaaacgatgtgcatgtcaacaccagtcctagaacccacaaaagtaaccttt
tctgtttcaccgattgaagcgacggagaaatgtaagaaagtggagaagggtaatcgaggg
cttaaaaacataccagactcgaaggaggcacctgtgaacctgtgtaaacccagtttagga
aaatcaacaatcaaaacgaataccccaataggctgcaaagttagaaaaactgaaattata
agttacccaagaccaaacttcaagaatgtcaaagcaaaagttatgtctagagcagtgttg
cagcccaaagatgctgctttatcaaaggtcacgcccagacctcagcagaccagtgcctca
tcaccctcatcagtgaattcaagacaacaaacagtcttgagcagaacaccgagatctgac
ttgaatgcagacaaaaaagcagaaattctaattaacaagacacataagcagcagtttaat
aaactcattactagccaggctgtgcatgttacaactcattctaaaaatgcttcacacagg
gttccaagaacaacatctgccgtgaaatcgaatcaggaagatgttgacaaagccagttct
tctaactcagcatgcgagaccgggtccgtttctgcgttgtttcagaagatcaaaggcata
ctccctgttaaaatggaaagtgcagaatgtttggaaatgacctatgttcccaacattgat
aggattagccctgaaaagaagggtgaaaaagaaaatgggacatctatggaaaaacaagag
ctgaaacaagagattatgaatgagacttttgaatatggttctctgtttttgggctctgct
tcaaaaacaacgaccacctcaggtaggaatatatccaagcctgactcctgcggtttgagg
caaatagctgctccaaaagccaaagtggggccccctgtttcctgtttgaggcggaacagt
gacaatagaaatcccagtgctgatcgagccgtatctcctcagaggatcaggcgtgtgtcc
agttctggaaagcctacatccttgaaaactgcacagtcgtcatgggtgaatttgcctaga
ccacttcctaaatccaaagcatctttgaaaagtcctgcgctgcggaggacaggaagcacc
ccctcaatagccagcacccacagtgagctgagcacttacagcaacaattctggtaatgcc
gctgtcatcaaatatgaggagaaacctccaaaaccagcatttcagaatggttcctcagga
tccttttatttgaagcctttggtatccagggctcatgttcacttgatgaaaactcctcca
aaaggtccttcgagaaaaaatttatttacagctcttaatgcagttgaaaagagcaggcaa
aagaatcctcgaagcttatgtatccagccacagacagctcccgatgcgctgccccctgag
aaaacacttgaattgacgcaatataaaacaaaatgtgaaaaccaaagtggatttatcctg
cagctcaagcagcttcttgcctgtggtaataccaagtttgaggcattgacagttgtgatt
cagcacctgctgtctgagcgggaggaagcactgaaacaacacaaaaccctatctcaagaa
cttgttaacctccggggagagctagtcactgcttcaaccacctgtgagaaattagaaaaa
gccaggaatgagttacaaacagtgtatgaagcattcgtccagcagcaccaggctgaaaaa
acagaacgagagaatcggcttaaagagttttacaccagggagtatgaaaagcttcgggac
acttacattgaagaagcagagaagtacaaaatgcaattgcaagagcagtttgacaactta
aatgctgcgcatgaaacctctaagttggaaattgaagctagccactcagagaaacttgaa
ttgctaaagaaggcctatgaagcctccctttcagaaattaagaaaggccatgaaatagaa
aagaaatcgcttgaagatttactttctgagaagcaggaatcgctagagaagcaaatcaat
gatctgaagagtgaaaatgatgctttaaatgaaaaattgaaatcagaagaacaaaaaaga
agagcaagagaaaaagcaaatttgaaaaatcctcagatcatgtatctagaacaggagtta
gaaagcctgaaagctgtgttagagatcaagaatgagaaactgcatcaacaggacatcaag
ttaatgaaaatggagaaactggtggacaacaacacagcattggttgacaaattgaagcgt
ttccagcaggagaatgaagaattgaaagctcggatggacaagcacatggcaatctcaagg
cagctttccacggagcaggctgttctgcaagagtcgctggagaaggagtcgaaagtcaac
aagcgactctctatggaaaacgaggagcttctgtggaaactgcacaatggggacctgtgt
agccccaagagatcccccacatcctccgccatccctttgcagtcaccaaggaattcgggc
tccttccctagccccagcatttcacccagatga

DBGET integrated database retrieval system