KEGG   Homo sapiens (human): 57521Help
Entry
57521             CDS       T01001                                 

Gene name
RPTOR, KOG1, Mip1
Definition
(RefSeq) regulatory associated protein of MTOR complex 1
  KO
K07204  regulatory associated protein of mTOR
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    57521 (RPTOR)
   04152 AMPK signaling pathway
    57521 (RPTOR)
   04150 mTOR signaling pathway
    57521 (RPTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    57521 (RPTOR)
   04136 Autophagy - other
    57521 (RPTOR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    57521 (RPTOR)
  09149 Aging
   04211 Longevity regulating pathway
    57521 (RPTOR)
   04213 Longevity regulating pathway - multiple species
    57521 (RPTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    57521 (RPTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    57521 (RPTOR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    57521 (RPTOR)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    57521 (RPTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Raptor_N HEAT HEAT_2 WD40 Cnd1
Motif
Other DBs
NCBI-GeneID: 57521
NCBI-ProteinID: NP_065812
OMIM: 607130
HGNC: 30287
Ensembl: ENSG00000141564
Vega: OTTHUMG00000177622
Pharos: Q8N122(Tbio)
UniProt: Q8N122 Q6DKI0
Structure
PDB: 

Position
17q25.3
AA seq 1335 aa AA seqDB search
MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYHTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLVSDGSPMVR
KELVVALSHLVVQYESNFCTVALQFIEEEKNYALPSPATTEGGSLTPVRDSPCTPRLRSV
SSYGNIRAVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLGSPENEEHILS
FETIDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSIAYK
ATVNARPQRVLDTSSLTQSAPASPTNKGVHIHQAGGSPPASSTSSSSLTNDVAKQPVSRD
LPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFC
DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRLDDQIFLN
RNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
SGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALS
ECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALD
IHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYYISVYSVEKRVR
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgaaatgctgcaatcgcctcttctgggcctgggggaggaagatgaggctgat
cttacagactggaacctacctttggcttttatgaaaaagaggcactgtgagaaaattgaa
ggctccaaatccttagctcagagctggaggatgaaggatcggatgaagacagtcagtgtt
gccttagttttgtgcctgaatgttggtgtggaccctcccgatgtggtgaagaccacgccc
tgtgcacgcttggaatgctggatcgatcctctgtcgatgggtcctcagaaagctctggaa
accatcggtgcaaatttacagaagcagtacgagaactggcagccaagggcccggtacaag
cagagccttgacccaactgtggatgaagtcaagaagctctgcacgtccttacgtcgcaac
gccaaggaggagcgagtcctctttcactacaatggccacggggtgccccggcccacagtc
aacggggaggtctgggtcttcaacaagaactacacgcagtacatccctctgtccatatat
gacctgcagacgtggatgggcagcccgtcgatcttcgtctacgactgctccaatgctggc
ttgatcgtcaagtccttcaagcagttcgcactacagcgggagcaggagctggaggtagct
gcaatcaacccaaatcaccctcttgctcagatgcctttgcctccgtcgatgaaaaactgc
atccagctggcagcctgcgaggccaccgagctgctgcccatgatccccgacctcccggct
gacctattcacctcctgcctcaccacccccatcaagatcgccctgcgctggttttgcatg
cagaaatgtgtcagtctggtgcctggcgtcacactggatttgatagaaaagatccctggc
cgcctgaacgacaggaggacgcccctgggtgaactgaactggatcttcacagccatcaca
gacaccatcgcgtggaacgtgctcccccgggatctcttccaaaagctcttcagacaggac
ttgctggtggctagtctgtttcgaaattttttattggcggaaaggattatgaggtcgtat
aactgcactcccgtcagcagcccgcgtctgccgcccacgtacatgcacgccatgtggcaa
gcctgggacctggctgttgacatctgtctgtctcagctgccgacgatcatcgaggaaggc
actgcgtttcggcacagcccgttcttcgccgagcagctgaccgcattccaggtgtggctc
accatgggcgtggagaaccgaaacccacccgaacagctgcccatcgtcctgcaggtgctg
ttaagccaagtgcaccggctgagagcattggacttgcttggaagatttttggacctgggt
ccctgggcagtgagcctggccttgtctgtcggcatcttcccctacgtgctgaagctgctc
cagagctcggcccgagagctgcggccacttctcgttttcatctgggccaagatcctcgca
gtggacagctcgtgccaagcggacctcgtgaaggacaacggccacaagtacttcctgtcg
gtcctggcggacccctacatgccagctgaacaccggaccatgacggctttcattctcgcc
gtgatcgtcaacagctatcacacggggcaggaagcctgccttcagggaaacctcattgcc
atctgcctggagcagctcaacgacccgcaccccttgctgcgccagtgggtggccatctgc
ctcggcaggatctggcagaacttcgactcggcgaggtggtgcggcgtgagggacagcgct
catgagaagctctacagcctcctctccgaccccattcccgaggtccgctgcgcagcggtc
ttcgcccttggcacgttcgtgggcaactctgcagagaggacggaccactccaccaccatc
gaccacaacgtggccatgatgctggcccagctggtcagcgacgggagccccatggtccgg
aaggagctggtggtggctctgagtcatcttgtggttcagtatgaaagcaatttctgcacc
gtggccctgcagttcatagaagaggaaaagaactacgccttgccttctccagcaaccaca
gagggagggagtttgaccccagtgcgagacagcccgtgcacccccagacttcgttctgtg
agctcctatggaaacatccgtgctgtcgccacagccaggagcctcaacaaatctttgcag
aacctgagtttgacagaggaatctggtggcgcggtggcgttctcccccggaaacctcagc
accagcagcagcgccagcagcaccctgggcagccccgagaatgaggagcatatcctgtcc
ttcgagaccatcgacaagatgcgccgcgccagctcctactcctccctcaactccctcatc
ggagtttcctttaacagtgtttacactcagatttggagagtcctgctgcacctggctgct
gacccctatccagaggtctcggacgtggccatgaaagtactcaacagcatcgcctacaag
gccaccgtgaacgcccggccgcagcgcgtcctggacacctcctccctcacgcagtcggcc
cccgccagccccaccaacaagggcgtgcacatccaccaggcggggggctcccctccggcg
tccagcaccagcagctccagcctgaccaacgatgtggccaagcagccggtcagccgagac
ttgccttctggccggccgggcaccacaggccccgctggggcgcagtacacccctcactcc
caccagttcccccggacacggaagatgttcgacaagggcccagagcagactgcggacgac
gcggacgatgctgctggacacaaaagtttcatctccgccacggtgcagacggggttctgc
gactggagcgcccgctattttgcccagcccgtcatgaagatcccagaagagcacgacctg
gagagtcagatccgcaaggagcgggagtggcggttcctgcgaaacagccgtgtcaggagg
caggcccagcaagtcattcagaagggcattacgagattggacgaccaaatatttctgaac
aggaaccccggcgtcccctctgtggtgaaattccaccccttcacgccgtgcatcgccgta
gccgacaaggacagcatctgcttttgggactgggagaaaggggagaagctggattatttc
cacaatgggaaccctcggtacacgagggtcactgccatggagtatctgaacggccaggac
tgctcgcttctgctgacggccacagacgatggtgccatcagggtctggaagaattttgct
gatttggaaaagaacccagagatggtgaccgcgtggcaggggctctcggacatgctgcca
acgacgcgaggagctgggatggtggtggactgggagcaggagaccggcctcctcatgagc
tcaggagacgtgcggatcgtccggatctgggacacagaccgtgagatgaaggtgcaggac
atccctacgggcgcagacagctgtgtgacgagtctgtcctgtgattcccaccgctcactc
atcgtggctggcctcggtgacggctccatccgcgtctacgacagaaggatggcactcagc
gaatgccgcgtcatgacgtaccgggagcacacagcctgggtggtgaaggcctccctgcag
aagcgtcccgacggccacatcgtgagtgtgagcgtcaatggagatgtgcgcatctttgat
ccccggatgcctgagtcggtaaatgtgcttcagatcgtgaaggggctgacggccctggac
atccacccccaggcggacctgatcgcatgtggctccgtcaatcagttcaccgccatctac
aacagcagcggagagctcatcaacaacatcaagtactacgacggcttcatgggccagcgg
gtcggcgccatcagctgcctggccttccacccgcactggcctcacctggccgtgggaagc
aacgactactacatctccgtgtactcggtggagaagcgtgtcagatag

DBGET integrated database retrieval system