KEGG   Homo sapiens (human): 57529Help
Entry
57529             CDS       T01001                                 

Gene name
RTL9, MAR9, MART9, RGAG1, SIRH10
Definition
(RefSeq) retrotransposon Gag like 9
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Retrotrans_gag
Motif
Other DBs
NCBI-GeneID: 57529
NCBI-ProteinID: NP_065820
OMIM: 300965
HGNC: 29245
Ensembl: ENSG00000243978
Vega: OTTHUMG00000022196
Pharos: Q8NET4(Tdark)
UniProt: Q8NET4
Position
Xq23
AA seq 1388 aa AA seqDB search
MSIPLHSLRFNNTMREENVEPQNKQMAFCRPMTETRADVQILHSHVQLPIVSTSASDPGG
TSTQLMTSPVFDTMSAPLMGVPNSGALSPPLMPASDSGALSPLLMPASDSGALSPLLMPA
LDSGTLSPLLSTSEYGVMSPGMMTIPDFGTMSATLMVAPDSAEISPLAMPAPSSGVVCTP
IMSTSSSEAMSTPLMLAPDSGELSPILMQDMNPGVMSTQPVPAPSSEAMSPLQITDEDTE
AMSKVLMTALASGEISSLLMSGTDSEAISSLIMSAVASGGTSPQPTSTQNSGGIPTPLMS
DLDSGIMSSLLMSSPGSEVMSTPLLSVPDAGEMSTLPKPAPDAEAMSPALMTALPSGVMP
TQTMPAPGSGAMSPWSTQNVDSEMMSNPPVRATASGVMSAPPVRALDSGAMSTPLMGAPA
SGNMSTLQKTVPASGAMTTSLMTVPSSGVMSTEQMSATASRVMSAQLTMAKTSGAMPTGS
MKAVAKQYKRATASGKMSTPLRRAPTSGAMSTQPVTATASETMSMPQLTVPASGSMSMLQ
MRAPVSEAMSMPQMRTMASGLTSAAQMKAMTSGAMSTPLMTAQTSGSTSTLLMRDTASGV
MSCPQMRSLASGALSKPLMTPKASGTMFTEKMTTTASEAMPTLLMRDTVSGALSMPQMTD
TASGGLSASLMRDTASGAMSTSQMTATVSGGMSMPLMRAQDPGVMPASLMRAKVSGKMLS
QPMSTQDPGGMSMSPMKSMTAGGMQMNSPTSDVMSTPTVRAWTSETMSTPLMRTSDPGER
PSLLTRASSSGEMSLPLMRAPASGEIATPLRSPAYGAMSAPQMTATASGMMSSMPQVKAP
ISGAMSMPLTRSTASGGMSMPLMRAPDSRVTSTSQMMPTASGDMCTLPVRAPASGGVSSP
LVRAPASGTMSTPLRRPSACETVSTELMRASASGHMSTAQTTAMVSGGMSKPLMRAPASG
TMPMPLMSAMASGEMSMPLMETMASGATSTLQTSVANSRSMSLSQTTYTVSGRMATAPIR
ASASGARSTSFMRASVSGSMPMPLPRATASGCGMGMSMPQMTATDSRGMSTPLMRASGPG
TMSTPQTAFGVMSTPEIKATDSGEASTSHINITASGSKPTSHMTATTPETAKPPPKEVPS
FGMLTPALCYLLEEQEAARGSCSVEEEMEIDEEKQMKGFLDDSERMAFLVSLHLGAAERW
FILQMEVGEPLSHENKSFLRRSQGIYDSLSEIDILSAVLCHPKQGQKSVRQYATDFLLLA
RHLSWSDAILRTRFLEGLSEAVTTKMGRIFLKVAGSLKELIDRSLYTECQLAEEKDSPGN
SSQVLPTACKRNNEEAMGNELSSQQQTEEHQHVSKRCYYLKEHGDPQEGLHDHLGQSTGH
HQKAHTNK
NT seq 4167 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatacccttacattcactgcgattcaacaatacaatgagggaggaaaatgttgag
ccccaaaacaagcagatggccttctgtagaccaatgacagagaccagagcagacgtacag
attctgcattctcatgtacagttgcctatagtctcaacttcagcctcagaccctggaggg
acatccacacagttgatgacatctccagtctttgacaccatgtctgcacctctaatggga
gtaccaaactctggagcattgtccccacccctaatgccagcctcagactctggggcactt
tccccattgctaatgccagcctcagactctggggcactgtccccattgctaatgccagcc
ttagattctggaacattgtccccattgctgtccacttcagagtatggggtaatgtcccca
gggatgatgacaattcctgattttggaacgatgtccgcaacgctaatggtagcaccagat
tctgcagagatatcaccattggcaatgccagctccatcctctggagtggtgtgtacacct
ataatgagcacttcatcctctgaggcaatgtccacaccattaatgctagccccagattct
ggagagttatccccaattctaatgcaagatatgaatcctggagtgatgtctacacagcca
gtgccagctcccagctctgaggcaatgtccccattgcaaattacagatgaagacaccgaa
gcaatgtccaaagtgctaatgactgctctagcctctggagagatatcttcgctgctaatg
tcaggcacggactctgaagcaatatcctcactgataatgtcagctgtagcttctggaggt
acatcaccccagccaacaagcacccaaaactctgggggaatacctaccccgctcatgtca
gatctagactctggaataatgtcatcgcttttaatgtcatctccaggctctgaagtaatg
tccacaccgctactgtcagtcccagatgctggagaaatgtccacattaccaaagccagct
ccagatgctgaagcaatgtccccagcactaatgacggccctaccctctggagtgatgccc
acccaaacgatgccagccccaggctctggggcgatgtccccatggtcaacacaaaatgta
gactctgaaatgatgtctaatccgccagtgagagcaacagcctctggggtgatgtctgca
ccaccagtaagagctttagattctggagcaatgtccacaccgctaatgggagccccagcc
tctggaaatatgtctacattgcaaaagacagttccagcctctggagccatgaccacctca
ctgatgacagtcccaagctctggagtgatgtccacagagcaaatgtcagccacagcctct
agagtaatgtccgcacagttaacaatggccaaaacttctggagcaatgcccacaggctct
atgaaagccgtggcaaaacaatacaagagagccacagcctctggaaagatgtccacgcca
ctgaggagagctccaacttctggagcaatgtccacccaaccagttacggcaacagcctct
gaaacaatgtccatgccacaattgacagtcccagcctctggatcaatgtccatgctgcaa
atgagagcccctgtctctgaagcaatgtccatgccacaaatgagaaccatggcctcagga
ttgacatctgcagcacagatgaaagccatgacttctggagcaatgtccaccccactaatg
acagcccaaacctctggatcaacatccacgctgttaatgagagacacagcctcaggagtg
atgtcctgtccacaaatgagatctctggcctctggagcattgtccaagccactaatgaca
cccaaagcctcaggaacgatgttcacggagaaaatgacaaccacagcttctgaagcaatg
cccacactgctaatgagagacacagtttctggagctctgtccatgccgcaaatgacagac
acagcctctggagggttgtctgcatcgctaatgagagacacagcttctggagcaatgtcc
acatcacaaatgacagccacagtctctggagggatgtccatgccactaatgagagctcaa
gacccaggagtaatgcctgcctcactaatgagagccaaagtgtctggaaagatgctcagt
cagccaatgagcacccaagatcctggagggatgtccatgtcgcccatgaagtccatgacc
gctggagggatgcagatgaattccccaacctctgatgtgatgtccacaccaacagtgaga
gcctggacctctgaaacaatgtccacaccactaatgagaacctcagaccctggagagagg
ccctcactgctcacaagagcttcatcctctggagagatgtccctaccactaatgagagct
ccagcttctggagagatagccacgcctctgagatccccagcttatggagccatgtctgct
ccacaaatgacagccacagcctctggaatgatgtcatccatgccacaagtgaaggctccc
atctctggagcaatgtccatgccactaacaagatccacagcctctggagggatgtccatg
ccactgatgagagccccagactctagagtgacatccacatcacaaatgatgcccacagct
tctggagacatgtgcacactaccagtgcgagccccagcctctggaggggtgtcctcacca
ctagtaagagctccagcctctggaactatgtccacaccactaaggagaccctcagcctgt
gagactgtgtccacagagttaatgagagcttcagcctctggacatatgtccactgcacaa
acaacagccatggtctctggagggatgtccaagccattaatgagagccccggcctctgga
acaatgcccatgcctttaatgtcagccatggcttctggagagatgtctatgccgctaatg
gaaaccatggcctctggagcaacgtccacattgcaaaccagtgttgcgaactctagatct
atgtccttgtcacaaacaacatataccgtgtctggaaggatggccacagcgccaattaga
gcctctgcttctggagcaaggtccacatcatttatgagagcctcagtttctggatcgatg
cccatgccactaccaagagccacagcctctggatgtggcatgggtatgtccatgccacaa
atgacagccacagactctagagggatgtccacaccactaatgagggcctcaggccctgga
acaatgtccacaccacagacagcctttggagtgatgtccactccggaaatcaaagccaca
gactctggagaggcatccacctctcacattaacatcacagcctctggatcaaagcccaca
tcgcacatgactgccacaactcctgaaactgcgaaaccaccaccaaaggaagtgccatcc
ttcggaatgttgaccccagcactctgctacctcttagaagagcaggaagcagcccggggc
tcatgctctgtggaggaagagatggagattgatgaggagaagcaaatgaaggggtttttg
gacgattcagagagaatggcatttctggtatctcttcatctgggagcagcagagaggtgg
ttcatcttgcaaatggaggtaggagaacctctctcacatgaaaataaatctttcctgaga
agatcccagggcatatatgactccctatctgagatagacatcctcagtgctgttctttgc
catcccaaacagggccaaaagtcagtcaggcagtatgccactgacttcctgctgctggcc
cgacatttgtcttggtctgatgccattctacggaccaggtttctggaaggactctcagaa
gctgttaccaccaaaatgggtcggatcttcctgaaggtggctggcagcctaaaggagctg
atagacaggtctctgtacaccgagtgccagctggctgaagagaaggattccccaggcaac
tcaagccaggttctgccaacagcctgtaagcggaataatgaggaggccatggggaatgaa
ctgagctctcagcagcagactgaggagcaccagcatgtttccaaacgctgttactacctg
aaagagcatggagacccccaagaaggtcttcatgatcaccttggacagagcacaggccat
catcagaaggcccataccaacaagtaa

DBGET integrated database retrieval system