KEGG   Homo sapiens (human): 57530
Entry
57530             CDS       T01001                                 

Gene name
CGN
Definition
(RefSeq) cingulin
  KO
K06102  cingulin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    57530 (CGN)
SSDB
Motif
Pfam: Myosin_tail_1 DHR10 ADIP DUF1664
Other DBs
NCBI-GeneID: 57530
NCBI-ProteinID: NP_065821
OMIM: 609473
HGNC: 17429
Ensembl: ENSG00000143375
Vega: OTTHUMG00000012497
Pharos: Q9P2M7(Tbio)
UniProt: Q9P2M7
Position
1q21.3
AA seq 1203 aa
MEQAPNMAEPRGPVDHGVQIRFITEPVSGAEMGTLRRGGRRPAKDARASTYGVAVRVQGI
AGQPFVVLNSGEKGGDSFGVQIKGANDQGASGALSSDLELPENPYSQVKGFPAPSQSSTS
DEEPGAYWNGKLLRSHSQASLAGPGPVDPSNRSNSMLELAPKVASPGSTIDTAPLSSVDS
LINKFDSQLGGQARGRTGRRTRMLPPEQRKRSKSLDSRLPRDTFEERERQSTNHWTSSTK
YDNHVGTSKQPAQSQNLSPLSGFSRSRQTQDWVLQSFEEPRRSAQDPTMLQFKSTPDLLR
DQQEAAPPGSVDHMKATIYGILREGSSESETSVRRKVSLVLEKMQPLVMVSSGSTKAVAG
QGELTRKVEELQRKLDEEVKKRQKLEPSQVGLERQLEEKTEECSRLQELLERRKGEAQQS
NKELQNMKRLLDQGEDLRHGLETQVMELQNKLKHVQGPEPAKEVLLKDLLETRELLEEVL
EGKQRVEEQLRLRERELTALKGALKEEVASRDQEVEHVRQQYQRDTEQLRRSMQDATQDH
AVLEAERQKMSALVRGLQRELEETSEETGHWQSMFQKNKEDLRATKQELLQLRMEKEEME
EELGEKIEVLQRELEQARASAGDTRQVEVLKKELLRTQEELKELQAERQSQEVAGRHRDR
ELEKQLAVLRVEADRGRELEEQNLQLQKTLQQLRQDCEEASKAKMVAEAEATVLGQRRAA
VETTLRETQEENDEFRRRILGLEQQLKETRGLVDGGEAVEARLRDKLQRLEAEKQQLEEA
LNASQEEEGSLAAAKRALEARLEEAQRGLARLGQEQQTLNRALEEEGKQREVLRRGKAEL
EEQKRLLDRTVDRLNKELEKIGEDSKQALQQLQAQLEDYKEKARREVADAQRQAKDWASE
AEKTSGGLSRLQDEIQRLRQALQASQAERDTARLDKELLAQRLQGLEQEAENKKRSQDDR
ARQLKGLEEKVSRLETELDEEKNTVELLTDRVNRGRDQVDQLRTELMQERSARQDLECDK
ISLERQNKDLKTRLASSEGFQKPSASLSQLESQNQLLQERLQAEEREKTVLQSTNRKLER
KVKELSIQIEDERQHVNDQKDQLSLRVKALKRQVDEAEEEIERLDGLRKKAQREVEEQHE
VNEQLQARIKSLEKDSWRKASRSAAESALKNEGLSSDEEFDSVYDPSSIASLLTESNLQT
SSC
NT seq 3612 nt   +upstreamnt  +downstreamnt
atggagcaggcacccaacatggctgagccccggggccccgtagaccatggagtccagatt
cgcttcatcacagagccagtgagtggtgcagagatgggcactctacgtcgaggtggacga
cgcccagctaaggatgcaagagccagtacctacggggttgctgtgcgtgtgcagggaatc
gctgggcagccctttgtggtgctcaacagtggggagaaaggcggtgactcctttggggtc
caaatcaagggggccaatgaccaaggggcctcaggagctctgagctcagatttggaactc
cctgagaacccctactctcaggtcaagggatttcctgccccctcgcagagcagcacatct
gatgaggagcctggggcctactggaatggaaagctactccgttcccactcccaggcctca
ctggcaggccctggcccagtggatcctagtaacagaagcaacagcatgctggagctagcc
ccgaaagtggcttccccaggtagcaccattgacactgctcccctgtcttcagtggactca
ctcatcaacaagtttgacagtcaacttggaggccaggcccggggtcggactggccgccga
acacggatgctaccccctgaacagcgcaaacggagcaagagcctggacagccgcctccca
cgggacacctttgaggaacgggagcgccagtccaccaaccactggacctctagcacaaaa
tatgacaaccatgtgggcacttcgaagcagccagcccagagccagaacctgagtcctctc
agtggctttagccgttctcgtcagactcaggactgggtccttcagagttttgaggagccg
cggaggagtgcacaggaccccaccatgctgcagttcaaatcaactccagacctccttcga
gaccagcaggaggcagccccaccaggcagtgtggaccatatgaaggccaccatctatggc
atcctgagggagggaagctcagaaagtgaaacctctgtgaggaggaaggttagtttggtg
ctggagaagatgcagcctctagtgatggtttcttctggttctactaaggccgtggcaggg
cagggtgagcttacccgaaaagtggaggagctacagcgaaagctggatgaagaggtgaag
aagcggcagaagctagagccatcccaagttgggctggagcggcagctggaggagaaaaca
gaagagtgcagccgactgcaggagctgctggagaggaggaagggggaggcccagcagagc
aacaaggagctccagaacatgaagcgcctcttggaccagggtgaagatttacgacatggg
ctggagacccaggtgatggagctgcagaacaagctgaaacatgtccagggtcctgagcct
gctaaggaggtgttactgaaggacctgttagagacccgggaacttctggaagaggtcttg
gaggggaaacagcgagtagaggagcagctgaggctgcgggagcgggagttgacagccctg
aagggggccctgaaagaggaggtagcctcccgtgaccaggaggtggaacatgtccggcag
cagtaccagcgagacacagagcagctccgcaggagcatgcaagatgcaacccaggaccat
gcagtgctggaggccgagaggcagaagatgtcagcccttgtgcgagggctgcagagggag
ctggaggagacttcagaggagacagggcattggcagagtatgttccagaagaacaaggag
gatcttagagccaccaagcaggaactcctgcagctgcgaatggagaaggaggagatggaa
gaggagcttggagagaagatagaggtcttgcagagggaattagagcaggcccgagctagt
gctggagatactcgccaggttgaggtgctcaagaaggagctgctccggacacaggaggag
cttaaggaactgcaggcagaacggcagagccaggaggtggctgggcgacaccgggaccgg
gagttggagaagcagctggcggtcctgagggtcgaggctgatcgaggtcgggagctggaa
gaacagaacctccagctacaaaagaccctccagcaactgcgacaggactgtgaagaggct
tccaaggctaagatggtggccgaggcagaggcaacagtgctggggcagcggcgggccgca
gtggagacgacgcttcgggagacccaggaggaaaatgacgaattccgccggcgcatcctg
ggtttggagcagcagctgaaggagactcgaggtctggtggatggtggggaagcggtggag
gcacgactacgggacaagctgcagcggctggaggcagagaaacagcagctggaggaggcc
ctgaatgcgtcccaggaagaggaggggagtctggcagcagccaagcgggcactggaggca
cgcctagaggaggctcagcgggggctggcccgcctggggcaggagcagcagacactgaac
cgggccctggaggaggaagggaagcagcgggaggtgctccggcgaggcaaggctgagctg
gaggagcagaagcgtttgctggacaggactgtggaccgactgaacaaggagttggagaag
atcggggaggactctaagcaagccctgcagcagctccaggcccagctggaggattataag
gaaaaggcccggcgggaggtggcagatgcccagcgccaggccaaggattgggccagtgag
gctgagaagacctctggaggactgagccgacttcaggatgagatccagaggctgcggcag
gccctgcaggcatcccaggctgagcgggacacagcccggctggacaaagagctactggcc
cagcgactgcaggggctggagcaagaggcagagaacaagaagcgttcccaggacgacagg
gcccggcagctgaagggtctcgaggaaaaagtctcacggctggaaacagagttagatgag
gagaagaacaccgtggagctgctaacagatcgggtgaatcgtggccgggaccaggtggat
cagctgaggacagagctcatgcaggaaaggtctgctcggcaggacctggagtgtgacaaa
atctccttggagagacagaacaaggacctgaagacccggttggccagctcagaaggcttc
cagaagcctagtgccagcctctctcagcttgagtcccagaatcagttgttgcaggagcgg
ctacaggctgaagagagggagaagacagttctgcagtctaccaatcgaaaactggagcgg
aaagttaaagaactatccatccagattgaagacgagcggcagcatgtcaatgaccagaaa
gaccagctaagcctgagggtgaaggctttgaagcgtcaggtggatgaagcagaagaggaa
attgagcgactggacggcctgaggaagaaggcccagcgtgaggtggaggagcagcatgag
gtcaatgaacagctccaggcccggatcaagtctctggagaaggactcctggcgcaaagct
tcccgctcagctgctgagtcagctctcaaaaacgaagggctgagctcagatgaggaattc
gacagtgtctacgatccctcgtccattgcatcactgcttacggagagcaacctacagacc
agctcctgttag

DBGET integrated database retrieval system