KEGG   Homo sapiens (human): 57539
Entry
57539             CDS       T01001                                 

Symbol
WDR35, CED2, FAP118, IFT121, IFTA1, SRTD7
Name
(RefSeq) WD repeat domain 35
  KO
K19674  WD repeat-containing protein 35
Organism
hsa  Homo sapiens (human)
Disease
H00511  Short rib-polydactyly syndrome
H00529  Cranioectodermal dysplasia
H02157  Short-rib thoracic dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    57539 (WDR35)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Intraflagellar transport (IFT) complex A
    57539 (WDR35)
SSDB
Motif
Pfam: ANAPC4_WD40 Coatomer_WDAD Clathrin eIF2A A2L_zn_ribbon ArdA
Other DBs
NCBI-GeneID: 57539
NCBI-ProteinID: NP_001006658
OMIM: 613602
HGNC: 29250
Ensembl: ENSG00000118965
Vega: OTTHUMG00000090737
Pharos: Q9P2L0(Tbio)
UniProt: Q9P2L0
Position
2p24.1
AA seq 1181 aa
MFFYLSKKISIPNNVKLQCVSWNKEQGFIACGGEDGLLKVLKLETQTDDAKLRGLAAPSN
LSMNQTLEGHSGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRS
MSWNADGQKICIVYEDGAVIVGSVDGNRIWGKDLKGIQLSHVTWSADSKVLLFGMANGEI
HIYDNQGNFMIKMKLSCLVNVTGAISIAGIHWYHGTEGYVEPDCPCLAVCFDNGRCQIMR
HENDQNPVLIDTGMYVVGIQWNHMGSVLAVAGFQKAAMQDKDVNIVQFYTPFGEHLGTLK
VPGKEISALSWEGGGLKIALAVDSFIYFANIRPNYKWGYCSNTVVYAYTRPDRPEYCVVF
WDTKNNEKYVKYVKGLISITTCGDFCILATKADENHPQEENEMETFGATFVLVLCNSIGT
PLDPKYIDIVPLFVAMTKTHVIAASKEAFYTWQYRVAKKLTALEINQITRSRKEGRERIY
HVDDTPSGSMDGVLDYSKTIQGTRDPICAITASDKILIVGRESGTIQRYSLPNVGLIQKY
SLNCRAYQLSLNCNSSRLAIIDISGVLTFFDLDARVTDSTGQQVVGELLKLERRDVWDMK
WAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDEILKDPEHPNK
DYLINFEIRSLRDSRALIEKVGIKDASQFIEDNPHPRLWRLLAEAALQKLDLYTAEQAFV
RCKDYQGIKFVKRLGKLLSESMKQAEVVGYFGRFEEAERTYLEMDRRDLAIGLRLKLGDW
FRVLQLLKTGSGDADDSLLEQANNAIGDYFADRQKWLNAVQYYVQGRNQERLAECYYMLE
DYEGLENLAISLPENHKLLPEIAQMFVRVGMCEQAVTAFLKCSQPKAAVDTCVHLNQWNK
AVELAKNHSMKEIGSLLARYASHLLEKNKTLDAIELYRKANYFFDAAKLMFKIADEEAKK
GSKPLRVKKLYVLSALLIEQYHEQMKNAQRGKVKGKSSEATSALAGLLEEEVLSTTDRFT
DNAWRGAEAYHFFILAQRQLYEGCVDTALKTALHLKDYEDIIPPVEIYSLLALCACASRA
FGTCSKAFIKLKSLETLSSEQKQQYEDLALEIFTKHTSKDNRKPELDSLMEGGEGKLPTC
VATGSPITEYQFWMCSVCKHGVLAQEISHYSFCPLCHSPVG
NT seq 3546 nt   +upstreamnt  +downstreamnt
atgttcttctacctgagcaagaaaatttccattcccaataacgtgaagctgcagtgtgta
tcctggaacaaggaacaagggttcatagcatgcggtggtgaagatggattactgaaagtt
ttgaaattagagacgcagacagatgatgcaaaattgaggggccttgcagcccccagtaac
ctttctatgaatcagactcttgaaggtcatagtggttctgttcaagttgtaacatggaat
gagcagtatcagaagttgactaccagtgatgaaaacgggcttatcattgtgtggatgtta
tataaaggctcttggattgaggagatgatcaacaatcgaaataaatcagttgttcgcagt
atgagctggaatgctgacggacagaagatctgcattgtatatgaagatggggctgtgata
gttggttcagtggatggcaatcgtatttggggaaaagacctgaagggtatacagctatcc
catgtaacatggtctgcggacagtaaagtcttactttttggaatggcaaatggggaaata
cacatttacgataatcaaggaaattttatgataaaaatgaaactgagttgtttggtgaat
gtcactggagctatcagcattgctggaattcattggtaccatggcacagaaggctacgtg
gagcctgattgcccttgccttgctgtttgctttgataatggaagatgccaaataatgaga
catgagaatgaccaaaatcccgttttgattgacactggcatgtacgtagtaggcatccag
tggaaccacatgggcagcgtgttagctgtggcaggcttccagaaggcagccatgcaggac
aaagatgtgaacattgtgcagttttacactccgtttggtgagcatctgggtactttgaaa
gttcctggaaaggaaatatctgcactatcttgggaaggaggtggactgaaaattgcacta
gctgttgattcctttatatattttgcaaacattcgacctaattataagtggggttattgc
tcaaacactgtagtttatgcatataccagacctgatcgtccagaatattgtgttgtcttc
tgggatacgaaaaacaatgaaaaatatgttaaatatgtgaagggtctcatttctattact
acctgtggagatttctgcattttggctacaaaagctgatgaaaatcatcctcaggaggag
aacgagatggagacatttggtgcaacgtttgtactagttctttgtaattctattggtaca
cccttggatcccaaatacattgatattgtaccattgtttgttgcaatgaccaaaacccat
gtgatagcagcctcgaaagaagcattttatacctggcaatatcgtgtggcaaagaagctc
acagcattggaaattaatcagatcacacggtctcgaaaagaagggagagaaagaatttat
catgttgatgataccccttctggatcaatggatggtgtgcttgattatagtaaaaccatt
caaggcacaagggatccaatttgtgccataactgcatcagataagatattgattgtgggt
cgtgaatctggcaccattcagagatacagtctacctaatgttggtttgattcaaaaatat
tcccttaattgtcgagcctaccagttatccttgaattgcaactctagccgtcttgctatc
atagacatctcaggagttctgactttctttgacttggatgctcgagtaacggacagtacg
ggacagcaagtagttggagagttgttaaaattggaacgaagagatgtctgggatatgaag
tgggccaaagataatcctgatttgtttgcaatgatggagaagacaagaatgtatgttttc
agaaacttggatcctgaggaacccattcagacctctggatatatttgtaattttgaggat
ttagaaattaaatctgttcttttggatgagatattaaaggatccagaacatccaaacaag
gattacctaattaactttgagattcggtctctgcgagatagccgagcactgattgagaag
gttggaattaaagatgcatctcagttcatagaggacaatccacacccccgactttggcgc
ctactggctgaagcagctcttcagaaactggatctatacactgcagagcaagcatttgtg
cgctgcaaagattaccaaggcattaagtttgtgaagcgcttgggcaaactactgagtgag
tcaatgaaacaggctgaagttgttggctacttcggcaggtttgaagaggctgaaagaacg
tatctcgagatggacagaagggatcttgctattggcctccggctgaaattgggggattgg
tttagagtactccagctcctgaaaactggatctggtgatgcagatgacagtctcctggaa
caagccaacaatgccattggagactactttgctgatcgacaaaagtggttgaatgctgta
caatattatgtacaaggacggaaccaggaacgcttagctgaatgttactatatgttagag
gattatgaagggttagagaaccttgccatttcacttccagaaaaccacaagttacttcca
gaaatagcacaaatgtttgtcagagttggaatgtgtgaacaagcagtgactgcatttttg
aaatgtagtcaaccaaaggcagcagtagatacctgcgtacatctcaaccaatggaacaaa
gctgttgaattggctaaaaatcatagtatgaaagaaattggatctctgttagctaggtat
gcatctcatttactggaaaagaataaaactcttgatgccatagaactctatcggaaagcc
aattacttttttgatgcagctaaactgatgtttaagattgcagatgaagaggcaaagaaa
ggaagtaaacctttacgtgtcaagaagctctatgtactgtcagccttacttatagagcaa
taccatgaacagatgaagaatgcccagcgaggaaaagttaaaggaaaaagttcagaggcc
acttctgccttggctggtttgctggaagaagaagttctgtctacaacagatcgtttcaca
gataatgcatggagaggggcagaggcttaccacttctttatacttgcacagaggcagctc
tatgagggatgtgtggacactgcactgaagacagctcttcacctgaaagactatgaagac
atcatccctcctgtggagatctactctctgctagcactctgcgcatgcgccagcagagcc
tttgggacttgttcaaaagctttcattaaacttaaatctttagagaccctcagttcagaa
cagaaacagcagtatgaagaccttgctttagaaatcttcaccaaacatacttcaaaagat
aacagaaaacctgaattggacagccttatggaaggtggagaagggaaactgccaacatgc
gttgccacaggaagcccaatcactgagtatcaattctggatgtgcagtgtatgcaaacac
ggtgtccttgctcaggaaataagccactacagcttctgccccttatgccatagtccagtg
ggataa

DBGET integrated database retrieval system