KEGG   Homo sapiens (human): 57553Help
Entry
57553             CDS       T01001                                 

Gene name
MICAL3, MICAL-3
Definition
(RefSeq) microtubule associated monooxygenase, calponin and LIM domain containing 3
  KO
K19947  F-actin monooxygenase [EC:1.14.13.225]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    57553 (MICAL3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.225  F-actin monooxygenase
     57553 (MICAL3)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    57553 (MICAL3)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    57553 (MICAL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3585 CH CAMSAP_CH LIM FAD_binding_3 Pyr_redox_3 Pyr_redox_2 NAD_binding_7 FAD_binding_2 NAD_binding_8 DAO HI0933_like Pyr_redox Thi4 AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 57553
NCBI-ProteinID: NP_056056
OMIM: 608882
HGNC: 24694
Ensembl: ENSG00000243156
Vega: OTTHUMG00000150067
Pharos: Q7RTP6(Tdark)
UniProt: Q7RTP6
Structure
PDB: 

Position
22q11.21
AA seq 2002 aa AA seqDB search
MEERKHETMNPAHVLFDRFVQATTCKGTLKAFQELCDHLELKPKDYRSFYHKLKSKLNYW
KAKALWAKLDKRGSHKDYKKGKACTNTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVN
VEFQGLIQPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQELREATGIDLENIVYYKDDTHYFV
MTAKKQSLLDKGVILHDYADTELLLSRENVDQEALLSYAREAADFSTQQQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREQNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGTSPLEVLAERESIYRLLPQTTPENVSKNFSQYSIDPVTRYPNINVNFLR
PSQVRHLYDTGETKDIHLEMESLVNSRTTPKLTRNESVARSSKLLGWCQRQTDGYAGVNV
TDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGKE
MASVGEPDKLSMVMYLTQFYEMFKDSLPSSDTLDLNAEEKAVLIASTRSPISFLSKLGQT
ISRKRSPKDKKEKDLDGAGKRRKTSQSEEEEAPRGHRGERPTLVSTLTDRRMDVAVGNQN
KVKYMATQLLAKFEENAPAQSIGIRRQGSMKKEFPQNLGGSDTCYFCQKRVYVMERLSAE
GKFFHRSCFKCEYCATTLRLSAYAYDIEDGKFYCKPHYCYRLSGYAQRKRPAVAPLSGKE
AKGPLQDGATTDANGRANAVASSTERTPGSGVNGLEEPSIAKRLRGTPERIELENYRLSL
RQAEALQEVPEETQAEHNLSSVLDTGAEEDVASSSSESEMEEEGEEEEEEPRLPPSDLGG
VPWKEAVRIHALLKGKSEEELEASKSFGPGNEEEEEEEEEYEEEEEEDYDEEEEESSEAG
NQRLQQVMHAADPLEIQADVHWTHIREREEEERMAPASESSASGAPLDENDLEEDVDSEP
AEIEGEAAEDGDPGDTGAELDDDQHWSDSPSDADRELRLPCPAEGEAELELRVSEDEEKL
PASPKHQERGPSQATSPIRSPQESALLFIPVHSPSTEGPQLPPVPAATQEKSPEERLFPE
PLLPKEKPKADAPSDLKAVHSPIRSQPVTLPEARTPVSPGSPQPQPPVAASTPPPSPLPI
CSQPQPSTEATVPSPTQSPIRFQPAPAKTSTPLAPLPVQSQSDTKDRLGSPLAVDEALRR
SDLVEEFWMKSAEIRRSLGLTPVDRSKGPEPSFPTPAFRPVSLKSYSVEKSPQDEGLHLL
KPLSIPKRLGLPKPEGEPLSLPTPRSPSDRELRSAQEERRELSSSSGLGLHGSSSNMKTL
GSQSFNTSDSAMLTPPSSPPPPPPPGEEPATLRRKLREAEPNASVVPPPLPATWMRPPRE
PAQPPREEVRKSFVESVEEIPFADDVEDTYDDKTEDSSLQEKFFTPPSCWPRPEKPRHPP
LAKENGRLPALEGTLQPQKRGLPLVSAEAKELAEERMRAREKSVKSQALRDAMARQLSRM
QQMELASGAPRPRKASSAPSQGKERRPDSPTRPTLRGSEEPTLKHEATSEEVLSPPSDSG
GPDGSFTSSEGSSGKSKKRSSLFSPRRNKKEKKSKGEGRPPEKPSSNLLEEAAAKPKSLW
KSVFSGYKKDKKKKADDKSCPSTPSSGATVDSGKHRVLPVVRAELQLRRQLSFSEDSDLS
SDDVLEKSSQKSRREPRTYTEEELNAKLTRRVQKAARRQAKQEELKRLHRAQIIQRQLQQ
VEERQRRLEERGVAVEKALRGEAGMGKKDDPKLMQEWFKLVQEKNAMVRYESELMIFARE
LELEDRQSRLQQELRERMAVEDHLKTEEELSEEKQILNEMLEVVEQRDSLVALLEEQRLR
EREEDKDLEAAMLSKGFSLNWS
NT seq 6009 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaggaagcatgagaccatgaacccagctcatgtcctctttgaccggtttgtc
caggccaccacctgcaagggaaccctcaaggctttccaggagctctgtgaccacctggaa
ctaaagccaaaggactaccgctccttctatcacaagctcaagtccaagcttaactactgg
aaagccaaagccctctgggcaaaattggacaaacggggcagtcacaaagactacaaaaag
ggaaaagcgtgcactaacaccaagtgtctcatcattggggctggcccctgtggtctccgt
acagccatcgacttatccttactgggggccaaggtggttgttattgagaaacgagatgcc
ttctcccgcaacaacgtcttgcatctctggccattcaccatacatgatctacgaggtctg
ggtgccaagaagttctatggcaagttctgtgctggagccatcgaccatatcagtatccgt
cagctccaactaatacttttgaaagtagccttgatcctaggcattgaaatccacgtcaat
gtggaattccaaggacttatacagcctcctgaggaccaagagaatgaacggataggctgg
cgggcactggtgcaccccaagactcatcctgtgtcagagtatgaatttgaagtgatcatc
ggtggggatggtcggaggaacaccttggaagggtttcgtcggaaagaattccgtggcaaa
ctggccatcgccatcacggcaaattttatcaaccgaaatacaacagcagaagctaaagtg
gaagagatcagtggtgtggcttttatattcaaccaaaaatttttccaggaactgagggaa
gccacaggtattgacttggagaacatcgtttactacaaagatgacacacactatttcgtt
atgacagccaaaaagcagagtttgctggacaaaggagtgatactacatgactacgccgac
acagagctcctgctttcccgagaaaacgtggaccaggaggctctgctcagctatgccagg
gaggcggcagacttctctacccagcagcagctgccgtctctggattttgccatcaatcac
tatgggcagcccgatgtggccatgtttgacttcacttgtatgtatgcctccgagaacgcc
gccttggtgcgggagcagaacggacaccagttactagtggctctggtcggggacagcctc
ctagagcctttctggccaatgggaacaggaatagcccggggctttctagctgctatggac
tctgcctggatggtccgaagttggtctctaggaacgagccctttggaagtgctggcagag
agggaaagtatttacaggttgctgcctcagaccacccctgagaatgtgagtaagaacttc
agccagtacagtatcgaccctgtcactcggtatcccaatatcaacgtcaacttcctccgg
ccaagccaggtgcgccatttatatgatactggcgaaacaaaagatattcacctggaaatg
gagagcctggtgaattcccgaaccacccccaaattgactcgcaatgagtctgtagctcgt
tcaagcaaactgctgggttggtgccagaggcagacagatggctatgcaggggtaaacgtg
acagatctcaccatgtcctggaaaagtggcttggccctttgtgcaattatccatagatac
cgccctgacctgatagattttgattctttggatgagcaaaatgtggagaagaataaccaa
ctggcctttgacattgctgagaaggaattgggcatttctcccatcatgacaggcaaagaa
atggcctccgtgggggagcctgataagctgtccatggtgatgtacctgactcagttctac
gagatgtttaaggactccctcccctctagcgacaccttggacctaaatgccgaggagaaa
gcagtcctgatagccagcaccagatcccctatctccttcctaagcaaacttggccagacc
atctctcggaagcgttctcccaaggataaaaaggaaaaggacttggatggtgctgggaag
aggagaaagaccagtcaatcagaggaggaggaagctcctcggggccacagaggagaaaga
ccgaccctggtgagcactctgacagacaggaggatggacgttgccgttgggaaccagaac
aaagtgaagtacatggcgacccagctgctggccaaatttgaagagaatgcgcccgcacag
tccatcggcatacggagacagggctccatgaagaaggagttcccgcagaacctgggaggc
agcgacacatgctacttctgccagaagcgggtctacgtgatggagaggctgagtgccgag
ggcaagttcttccaccggagctgcttcaagtgcgagtactgcgccaccaccctgcgcctc
tcggcctacgcctacgacatcgaggatggtaaattctactgtaagccacactactgctat
cgactctctggctacgcacaaaggaagagaccggcagtggctcccctgtctggaaaggag
gccaaaggacccctgcaggatggcgccaccacagatgcaaacggacgggccaacgccgtg
gccagctccactgagagaaccccaggttcaggcgtgaacggcctggaggagcccagcatc
gccaagcgactgaggggcaccccagagcggatcgagctggagaactaccgcctgtccctg
aggcaggctgaggcactgcaggaggtaccggaggagactcaggccgagcacaacctgagc
agcgtgctggacacgggcgccgaggaggacgtcgccagcagtagttccgagtctgagatg
gaggaggagggagaggaggaggaggaggagcctcgcctgcccccatctgacctgggtggt
gttccgtggaaggaggccgtgcggatccatgcccttctgaaagggaaaagtgaagaggag
ctagaggcctcaaagagctttgggcctgggaatgaagaggaggaggaggaggaggaagaa
tatgaagaggaggaggaggaggactatgacgaggaggaggaagagtccagtgaagccggg
aaccagaggctccagcaggtcatgcacgcggcggatcctctggagatccaggctgacgtg
cactggactcatatccgtgagagagaggaggaagagaggatggcgccggcctctgagtcc
tctgcttccggagccccattggatgagaatgacctagaggaagatgtggactcagaacca
gccgagatagaaggggaggcagcagaggatggggacccaggggacactggtgctgagctg
gatgatgatcagcactggtctgacagcccgtcggatgctgacagagagctgcgtttgccg
tgcccagctgagggggaagcagagctggagctgagggtgtcggaagatgaggagaagctg
cccgcctcaccgaagcaccaagagagaggtccctcccaagccaccagccccatccggtct
ccccaggaatcagctcttctgttcattccagtccacagcccctcaacagaggggccccaa
ctcccacctgtccctgccgccacccaggagaaatcacctgaggagcgccttttccctgag
cctttgctccccaaagagaagcccaaagctgatgccccctcggatctgaaagctgtgcac
tctcccatccgatcacagccagtgaccctgccagaagctaggactcctgtctcaccaggg
agcccgcagccccagccacccgtggcggcctccacgcccccacccagcccactccccatc
tgctcccagccccagccttccaccgaggccactgtcccatcccctacccagtcccccata
cgcttccagcctgccccggccaaaacatccaccccactggcccctctccctgtccaaagc
caaagtgacaccaaggacagactgggcagcccccttgctgtggatgaggccctcagacgg
agcgacctggtggaggagttctggatgaagagtgcggagatccgccgcagcctcgggctc
acacctgtggaccgcagcaaggggcccgagcccagcttccccacgcctgccttcaggcca
gtgtccctcaaatcctattccgttgaaaagtccccccaggatgagggactccaccttctc
aagcctctgtccatccccaaaaggctgggcctgccaaagccggaaggcgagccgttgtcc
ctgccaaccccccggtccccgtccgacagagagctacgcagcgcccaggaggagcgcagg
gagctgtccagcagctctggcctgggcctgcacgggagctcctccaacatgaagacactg
ggcagccagagcttcaacacctcggactccgccatgctcacgcccccctccagcccgccc
ccaccgccacccccgggcgaggagcccgccaccttgcggaggaagctcagggaggccgag
cccaatgcctcggtggtcccgccgcccttgcccgccacctggatgcggcccccccgggag
cctgctcagccccccagagaggaggtgcggaagtcgtttgtggagagcgtggaggagatt
ccctttgctgatgatgtggaggacacctatgacgacaagactgaggactcaagcctgcag
gagaaattcttcacgcccccgtcctgctggccgcgccccgagaagcctcgccacccgccc
ctggccaaggagaacgggaggctgcctgctctggaggggacgctgcagccacagaagagg
gggctgcccttggtgtccgcggaagccaaggagttggccgaggagcgcatgcgagccagg
gagaagtccgtgaagagccaggcgctgcgggacgccatggccaggcagctgagcaggatg
cagcagatggagctggcctcaggcgcccccaggccccgcaaggcgtcctcagcaccctcc
cagggcaaggagcgccggcctgactcccccacacgccccactctcaggggctccgaggag
cccaccctgaagcatgaagccaccagcgaggaggtcctctccccgccgtcggactcaggg
ggcccagatggctctttcacttcatccgagggctccagtgggaagagcaagaagaggtcg
tcactcttctccccccgcagaaacaagaaggagaagaagtccaaaggcgagggccggccc
ccggagaagcccagctccaacctcctagaagaagccgccgccaaacccaagtccctgtgg
aagtccgtcttctccgggtacaagaaggacaagaagaagaaggccgacgacaagtcctgc
cccagcaccccctccagcggggccacggtggactctggaaagcacagggtgcttcccgtc
gtaagggcagagctgcagctccggcgccagctgagcttctccgaggactcagacctctcc
agcgacgatgtccttgagaagtcctcacagaagtcccggcgagagccaagaacctacacg
gaggaggaactgaatgccaagctgacccggcgtgtgcaaaaggcagctcggagacaggcc
aagcaggaggagcttaagcggctgcatcgagcccagatcatccagcggcagctgcagcag
gtggaggagaggcagcggcggctggaggaaaggggcgtggctgtggagaaggcgctccgg
ggcgaagcaggcatgggcaagaaggacgaccccaagctgatgcaggagtggttcaagcta
gtgcaggagaagaacgccatggtgcgctacgagtcggagctgatgatctttgcccgggag
ctggagctggaagaccggcagagtcgactgcagcaggagctccgggaacgcatggcagtg
gaagatcaccttaagactgaggaggagctgtcagaagagaagcagattctcaatgagatg
ctggaggtggtggagcagagagactcactggtggcgctgctggaggagcagcggctccgg
gagagagaggaggacaaggacctggaggctgccatgctgtccaagggcttcagccttaac
tggtcctga

DBGET integrated database retrieval system