KEGG   Homo sapiens (human): 57556Help
Entry
57556             CDS       T01001                                 

Gene name
SEMA6A, HT018, SEMA, SEMA6A1, SEMAQ, VIA
Definition
(RefSeq) semaphorin 6A
  KO
K06842  semaphorin 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    57556 (SEMA6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sema PSI
Motif
Other DBs
NCBI-GeneID: 57556
NCBI-ProteinID: NP_065847
OMIM: 605885
HGNC: 10738
Ensembl: ENSG00000092421
Vega: OTTHUMG00000162987
Pharos: Q9H2E6(Tbio)
UniProt: Q9H2E6
Position
5q23.1
AA seq 1030 aa AA seqDB search
MRSEALLLYFTLLHFAGAGFPEDSEPISISHGNYTKQYPVFVGHKPGRNTTQRHRLDIQM
IMIMNGTLYIAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNF
IKVLLKKNDDALFVCGTNAFNPSCRNYKMDTLEPFGDEFSGMARCPYDAKHANVALFADG
KLYSATVTDFLAIDAVIYRSLGESPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIA
VEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVT
DVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIASVFTGRFKEQKSPDSTWTPVPDER
VPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNRPWFLRTMVRYRL
TKIAVDTAAGPYQNHTVVFLGSEKGIILKFLARIGNSGFLNDSLFLEEMSVYNSEKCSYD
GVEDKRIMGMQLDRASSSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWIKEGG
ACSHLSPNSRLTFEQDIERGNTDGLGDCHNSFVALNGHSSSLLPSTTTSDSTAQEGYESR
GGMLDWKHLLDSPDSTDPLGAVSSHNHQDKKGVIRESYLKGHDQLVPVTLLAIAVILAFV
MGAVFSGITVYCVCDHRRKDVAVVQRKEKELTHSRRGSMSSVTKLSGLFGDTQSKDPKPE
AILTPLMHNGKLATPGNTAKMLIKADQHHLDLTALPTPESTPTLQQKRKPSRGSREWERN
QNLINACTKDMPPMGSPVIPTDLPLRASPSHIPSVVVLPITQQGYQHEYVDQPKMSEVAQ
MALEDQAATLEYKTIKEHLSSKSPNHGVNLVENLDSLPPKVPQREASLGPPGASLSQTGL
SKRLEMHHSSSYGVDYKRSYPTNSLTRSHQATTLKRNNTNSSNSSHLSRNQSFGRGDNPP
PAPQRVDSIQVHSSQPSGQAVTVSRQPSLNAYNSLTRSGLKRTPSLKPDVPPKPSFAPLS
TSMKPNDACT
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcagaagccttgctgctatatttcacactgctacactttgctggggctggtttc
ccagaagattctgagccaatcagtatttcgcatggcaactatacaaaacagtatccggtg
tttgtgggccacaagccaggacggaacaccacacagaggcacaggctggacatccagatg
attatgatcatgaacggaaccctctacattgctgctagggaccatatttatactgttgat
atagacacatcacacacggaagaaatttattgtagcaaaaaactgacatggaaatctaga
caggccgatgtagacacatgcagaatgaagggaaaacataaggatgagtgccacaacttt
attaaagttcttctaaagaaaaacgatgatgcattgtttgtctgtggaactaatgccttc
aacccttcctgcagaaactataagatggatacattggaaccattcggggatgaattcagc
ggaatggccagatgcccatatgatgccaaacatgccaacgttgcactgtttgcagatgga
aaactatactcagccacagtgactgacttccttgccattgacgcagtcatttaccggagt
cttggagaaagccctaccctgcggaccgtcaagcacgattcaaaatggttgaaagaacca
tactttgttcaagccgtggattacggagattatatctacttcttcttcagggaaatagca
gtggagtataacaccatgggaaaggtagttttcccaagagtggctcaggtttgtaagaat
gatatgggaggatctcaaagagtcctggagaaacagtggacgtcgttcctgaaggcgcgc
ttgaactgctcagttcctggagactctcatttttatttcaacattctccaggcagttaca
gatgtgattcgtatcaacgggcgtgatgttgtcctggcaacgttttctacaccttataac
agcatccctgggtctgcagtctgtgcctatgacatgcttgacattgccagtgtttttact
gggagattcaaggaacagaagtctcctgattccacctggacaccagttcctgatgaacga
gttcctaagcccaggccaggttgctgtgctggctcatcctccttagaaagatatgcaacc
tccaatgagttccctgatgataccctgaacttcatcaagacgcacccgctcatggatgag
gcagtgccctccatcttcaacaggccatggttcctgagaacaatggtcagataccgcctt
accaaaattgcagtggacacagctgctgggccatatcagaatcacactgtggtttttctg
ggatcagagaagggaatcatcttgaagtttttggccagaataggaaatagtggttttcta
aatgacagccttttcctggaggagatgagtgtttacaactctgaaaaatgcagctatgat
ggagtcgaagacaaaaggatcatgggcatgcagctggacagagcaagcagctctctgtat
gttgcgttctctacctgtgtgataaaggttccccttggccggtgtgaacgacatgggaag
tgtaaaaaaacctgtattgcctccagagacccatattgtggatggataaaggaaggtggt
gcctgcagccatttatcacccaacagcagactgacttttgagcaggacatagagcgtggc
aatacagatggtctgggggactgtcacaattcctttgtggcactgaatgggcattccagt
tccctcttgcccagcacaaccacatcagattcgacggctcaagaggggtatgagtctagg
ggaggaatgctggactggaagcatctgcttgactcacctgacagcacagaccctttgggg
gcagtgtcttcccataatcaccaagacaagaagggagtgattcgggaaagttacctcaaa
ggccacgaccagctggttcccgtcaccctcttggccattgcagtcatcctggctttcgtc
atgggggccgtcttctcgggcatcaccgtctactgcgtctgtgatcatcggcgcaaagac
gtggctgtggtgcagcgcaaggagaaggagctcacccactcgcgccggggctccatgagc
agcgtcaccaagctcagcggcctctttggggacactcaatccaaagacccaaagccggag
gccatcctcacgccactcatgcacaacggcaagctcgccactcccggcaacacggccaag
atgctcattaaagcagaccagcaccacctggacctgacggccctccccaccccagagtca
accccaacgctgcagcagaagcggaagcccagccgcggcagccgcgagtgggagaggaac
cagaacctcatcaatgcctgcacaaaggacatgccccccatgggctcccctgtgattccc
acggacctgcccctgcgggcctcccccagccacatccccagcgtggtggtcctgcccatc
acgcagcagggctaccagcatgagtacgtggaccagcccaaaatgagcgaggtggcccag
atggcgctggaggaccaggccgccacactggagtataagaccatcaaggaacatctcagc
agcaagagtcccaaccatggggtgaaccttgtggagaacctggacagcctgccccccaaa
gttccacagcgggaggcctccctgggtcccccgggagcctccctgtctcagaccggtcta
agcaagcggctggaaatgcaccactcctcttcctacggggttgactataagaggagctac
cccacgaactcgctcacgagaagccaccaggccaccactctcaaaagaaacaacactaac
tcctccaattcctctcacctctccagaaaccagagctttggcaggggagacaacccgccg
cccgccccgcagagggtggactccatccaggtgcacagctcccagccatctggccaggcc
gtgactgtctcgaggcagcccagcctcaacgcctacaactcactgacaaggtcggggctg
aagcgtacgccctcgctaaagccggacgtaccccccaaaccatcctttgctcccctttcc
acatccatgaagcccaatgatgcgtgtacataa

DBGET integrated database retrieval system