KEGG   Homo sapiens (human): 5756
Entry
5756              CDS       T01001                                 

Gene name
TWF1, A6, PTK9
Definition
(RefSeq) twinfilin actin binding protein 1
  KO
K08870  twinfilin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    5756 (TWF1)
SSDB
Motif
Pfam: Cofilin_ADF
Other DBs
NCBI-GeneID: 5756
NCBI-ProteinID: NP_002813
OMIM: 610932
HGNC: 9620
Ensembl: ENSG00000151239
Vega: OTTHUMG00000169426
Pharos: Q12792(Tbio)
UniProt: Q12792
Position
12q12
AA seq 350 aa
MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVIGSYSQPSDSWDKDYDSFVLPL
LEDKQPCYILFRLDSQNAQGYEWIFIAWSPDHSHVRQKMLYAATRATLKKEFGGGHIKDE
VFGTVKEDVSLHGYKKYLLSQSSPAPLTAAEEELRQIKINEVQTDVGVDTKHQTLQGVAF
PISREAFQALEKLNNRQLNYVQLEIDIKNEIIILANTTNTELKDLPKRIPKDSARYHFFL
YKHSHEGDYLESIVFIYSMPGYTCSIRERMLYSSCKSRLLEIVERQLQMDVIRKIEIDNG
DELTADFLYEEVHPKQHAHKQSFAKPKGPAGKRGIRRLIRGPAETEATTD
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgtcccaccagaccggcatccaagcaagtgaagatgttaaagagatctttgccagagcc
agaaatggaaagtacagacttctgaaaatatctattgaaaatgagcaacttgtgattgga
tcatatagtcagccttcagattcctgggataaggattatgattcctttgttttacccctg
ttggaggacaaacaaccatgctatatattattcaggttagattctcagaatgcccaggga
tatgaatggatattcattgcatggtctccagatcattctcatgttcgtcaaaaaatgttg
tatgcagcaacaagagcaactctgaagaaggaatttggaggtggccacattaaagatgaa
gtatttggaacagtaaaggaagatgtatcattacatggatataaaaaatacttgctgtca
caatcttcccctgccccactgactgcagctgaggaagaactacgacagattaaaatcaat
gaggtacagactgacgtgggtgtggacactaagcatcaaacactacaaggagtagcattt
cccatttctcgagaagcctttcaggctttggaaaaattgaataatagacagctcaactat
gtgcagttggaaatagatataaaaaatgaaattataattttggccaacacaacaaataca
gaactgaaagatttgccaaagaggattcccaaggattcagctcgttaccatttctttctg
tataaacattcccatgaaggagactatttagagtccatagtttttatttattcaatgcct
ggatacacatgcagtataagagagcggatgctgtattctagctgcaagagccgtctgcta
gaaattgtagaaagacaactacaaatggatgtaattagaaagatcgagatagacaatggg
gatgagttgactgcagacttcctttatgaagaagtacatcccaagcagcatgcacacaag
caaagttttgcaaaaccaaaaggtcctgcaggaaaaagaggaattcgaagactaattagg
ggcccagcggaaactgaagctactactgattaa

DBGET integrated database retrieval system