KEGG   Homo sapiens (human): 57562Help
Entry
57562             CDS       T01001                                 

Gene name
CEP126, KIAA1377
Definition
(RefSeq) centrosomal protein 126
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: K1377
Motif
Other DBs
NCBI-GeneID: 57562
NCBI-ProteinID: NP_065853
OMIM: 614634
HGNC: 29264
Ensembl: ENSG00000110318
Vega: OTTHUMG00000167319
Pharos: Q9P2H0(Tdark)
UniProt: Q9P2H0
Position
11q22.1
AA seq 1117 aa AA seqDB search
MLAGRPGTRSAVGELGTESSDNLDRAPLGPRESGGHHRPGSYLDMKIHLEKNLEEERQIL
LQQQKICRNRARKYFVESNRRKKAFEEKRKEQEEKEHQIREQILQQRKQKFEEVTEKFQR
AHVPLSQRRKAVSRKPVPPLEEALKQIQESNLKSEVNLPFSRRPTINWRAIDSALPSALS
KNDHKHQKQLLSKINCEKEMNENMRATLATSKNVFQLKLEETQKLLEDQHLSNLQKFCDE
VNQITNSETLSSIDSLEATEHEEIYLTLNKEHSTSIQRNTISLKPANMQSTNLSCFDEDK
LAFSKTQHINNWLTNLDASNTQNVTAFSDILSKSNVLPSWEYFNSKEQNPSPLNGTVERA
TNTANNSVPFVSSPPMFVLDKKCEKTSETSTMRTTDSTSGAFKRERPLVTESPTFKFSKS
QSTSDSLTQEVATFPDQEKYSELNQENGTTSIPTSCVPVATPLVLPSNIQSARPSAKNSI
HIKEIDAVQCSDKLDELKDGKEEEIKYFNCNKEELPLFSDSFQDAYIPHNPDSKDEKQKL
AETSSLSNVTSNYDFVGQHKKMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFK
FGNQKAAAIRDSIELTKEKGAEIPKTIKKLRWFDETSNIENNAENSHSLKNKTGTTQQHS
QQFHIQSGAGSNIISVSTCAVNSADTKKSREDSISENVTTLGGSGADHMPLNCFIPSGYN
FAKHAWPASKKEESKIPVHDDSKTKQGKPQRGRAKIIRKPGSAKVQSGFICTNRKGAVIQ
PQSASKVNIFTQAQGKLIIPCPPPQSTSNIRSGKNIQVSQCQPVTPENPQNIITHNSFNS
KHVLPTEHSLNQWNQESSSPLSNACSDLVTVIPSLPSYCSSECQTFAKINHSNGTQAVAR
QDATLYCTQRSPVCEESYPSVTLRTAEEESVPLWKRGPNVLHQNKRATGSTVMRRKRIAE
TKRRNILEQKRQNPGSVGQKYSEQINNFGQSVLLSSSEPKQTTRGTSYIEEVSDSTSEFL
MAENLVKASVPEDEILTVLNSKQIQKSNLPLNKTQQFNICTLSAEEQKILESLNDLSERL
HYIQESICKNPSIKNTLQIIPLLEKREDRTSSCRDKR
NT seq 3354 nt NT seq  +upstreamnt  +downstreamnt
atgctggcggggaggcccggaacccggagcgcggtcggggaactgggcactgaatcatcg
gacaacctcgacagagcccccctcggccctcgggagagcggcgggcatcaccgacctggc
tcttacctagatatgaaaatccatctggagaaaaatttagaagaagagcgccagatatta
ctgcagcaacaaaaaatatgtcgaaatcgagcacgtaaatattttgtggagtcaaatcgg
agaaaaaaagcttttgaggagaaacgaaaagaacaggaagaaaaagaacaccaaattaga
gaacaaatacttcaacaaagaaaacagaagtttgaagaagttactgaaaaattccagcgt
gcccatgttcctctttcacagcggaggaaagcagtttcccgaaaaccagttcctccatta
gaagaggccctcaaacaaattcaggaatccaacttaaaatcagaagtaaaccttcccttt
tcccgtagaccaacaataaactggagagctatagattctgccttgccttccgcattatca
aaaaatgatcacaagcatcagaaacaactcttatccaaaatcaattgtgagaaagaaatg
aatgaaaacatgagggcaaccttggctactagcaaaaatgtgttccagcttaaactggag
gaaactcagaaactcctcgaagatcaacatctaagcaatttgcaaaaattttgtgatgaa
gttaatcagataaccaattctgaaaccctctcaagtatagacagtcttgaggctacagag
catgaagaaatatatttaacacttaataaggagcattccacatccatccagcggaatacc
atttccctcaaaccagcaaatatgcaatcaactaatctcagctgctttgatgaagataaa
ctggcattctctaaaactcaacatataaataattggcttacaaatttagatgcttcaaat
actcagaatgtcacagctttctcagatattttaagtaaatctaatgttctgccttcatgg
gaatattttaatagtaaagaacaaaatccatctcctttgaatggaacagtggaaagagcc
acaaatactgctaataattcagtaccctttgtatctagcccacccatgtttgtactagat
aaaaaatgtgaaaagacctctgaaactagcactatgaggacaactgactccacttctgga
gcattcaaaagagagagaccattagttactgagagcccaacatttaaatttagcaaatcc
caaagcacttcagattctctaacccaggaagtggctacatttccagaccaagagaaatat
tctgaattaaatcaagaaaatggaactacttcaattcctacttcatgtgtaccagtggca
acgcctttagttttgccatctaatatacagtcagctagaccttcagcaaagaacagtata
cacataaaagaaattgatgcagtgcagtgttctgataagttagatgaattgaaagatggt
aaagaagaagagataaaatattttaattgcaataaggaagagttgcctttattttcagac
agttttcaagatgcctatatacctcacaatcctgattcaaaagatgaaaaacaaaaatta
gctgaaacatcatccttgtctaatgtaacttctaattatgactttgttggccagcataag
aaaatgaaatacaacatccatgagagaaatggtgtgagatttcttaaaagtattttaaag
aaagaatctaaatatgaacatggttatcttaaggcattaattataaatcagagctttaag
tttggaaatcaaaaagcagcagctatcagagatagtattgaattaacaaaggaaaaaggt
gcagaaattccaaagaccattaaaaaactgaggtggtttgatgaaactagcaatatagaa
aacaatgctgaaaacagtcattcactgaagaataaaacaggaacaactcaacagcattct
caacaattccacattcaaagtggtgctggaagcaacataattagtgtttctacttgtgct
gtaaattctgctgatacaaagaagtccagggaggattctatctctgaaaatgttacgact
ttaggaggatctggagcagaccatatgcctttgaactgttttataccttcaggttataac
tttgctaaacatgcctggccagcctcaaaaaaagaagaaagtaaaatccctgtacatgat
gattctaaaactaagcaaggtaagccacaaagaggtagagcaaaaataattagaaaacca
ggatctgcaaaagtccaatcaggctttatatgtacaaacagaaaaggcgctgtcattcaa
ccacagtctgcaagcaaagtcaacatatttacacaagctcagggaaaattaattatacct
tgtcctcctcctcaatctacatcaaatattagaagtggtaaaaatatacaagtgtctcag
tgtcaaccagtaactcctgaaaatcctcaaaacattattacacataactcttttaattca
aaacatgtgcttccaacagaacacagtttgaatcagtggaatcaggaaagtagttctcca
ctctcaaatgcttgttctgacctagtcactgtgataccatcactgccatcatattgttct
tcagagtgccaaactttcgcaaaaataaatcattcaaatggcactcaagcagttgcccgg
caagatgcgacattatattgcacccaaagaagtcctgtttgtgaagaaagttatccgtct
gtgactctaagaactgctgaagaagaatcagttcccttatggaaaagaggtcctaatgtc
ctgcatcaaaataagagggctacagggtctactgttatgagaagaaaacgaattgctgaa
actaagcggagaaatattttagagcagaaaagacaaaaccctggatctgtaggacagaag
tacagtgagcaaattaataattttggacaaagtgtcctgctaagttcaagtgagccaaaa
caaactacaaggggtacttcttatattgaagaagtttcagatagtacttctgagtttttg
atggctgaaaacttagtgaaagcatcagtgccggaggatgagattctgactgtcttgaat
agcaaacagatacagaaatcaaatctacctttaaataaaactcaacaattcaacatctgc
acactgtcagctgaagaacagaagatcctagagtcccttaatgatctcagtgaaagacta
cattatatacaagaatccatttgcaaaaacccatccatcaaaaatactttacaaataata
ccacttctggagaagagagaagatagaaccagcagctgcagagacaagagataa

DBGET integrated database retrieval system