KEGG   Homo sapiens (human): 57569Help
Entry
57569             CDS       T01001                                 

Gene name
ARHGAP20, RARHOGAP
Definition
(RefSeq) Rho GTPase activating protein 20
  KO
K20641  Rho GTPase-activating protein 20
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    57569 (ARHGAP20)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    57569 (ARHGAP20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP RA IQ_SEC7_PH Nod1
Motif
Other DBs
NCBI-GeneID: 57569
NCBI-ProteinID: NP_065860
OMIM: 609568
HGNC: 18357
Ensembl: ENSG00000137727
Vega: OTTHUMG00000166590
Pharos: Q9P2F6(Tbio)
UniProt: Q9P2F6
Structure
PDB: 

Position
11q22.3-q23.1
AA seq 1191 aa AA seqDB search
MEAMSPQQETLGGQPGRSSSLTGVSRLAGGSCTKKKMKTLAERRRSAPSLILDKALQKRP
TTRDSPSASVDTCTFLSSLVCSNRTLLIDGRAELKRGLQRQERHLFLFNDLFVVAKIKYN
NNFKIKNKIKLTDMWTASCVDEVGEGNTNAMKSFVLGWPTVNFVATFSSPEQKDKWLSLL
QRYINLEKEKDYPKSIPLKIFAKDIGNCAYSKTITVMNSDTANEVINMSLPMLGITGSER
DYQLWVNSGKEEAPYPLIGHEYPYGIKMSHLRDSALLTPGSKDSTTPFNLQEPFLMEQLP
REMQCQFILKPSRLAAAQQLSDSGHKTFKRRRSIINWAFWRGSSTHLDNLPSSPTSPMPG
QLFGISLPNICENDNLPKPVLDMLFFLNQKGPLTKGIFRQSANVKSCRELKEKLNSGVEV
HLDCESIFVIASVLKDFLRNIPGSIFSSDLYDHWVSVMDQGNDEEKINTVQRLLDQLPRA
NVVLLRYLFGVLHNIEQHSSSNQMTAFNLAVCVAPSILWPPASSSPELENEFTKKVSLLI
QFLIENCLRIFGEEITSLFREVSVRCDTRENASDISCFQLNDSSYDSLENELNEDVDAPC
SDLVKKLGQGSRSMDSVLTLSDYDLDQPEVEGLLTLSDFDLAHSKDEDVQMKRPLESKPV
NILVYTKIPLRDHARAPSAMCTPSYLSTAAANAAKSLRRHRRCSEPSIDYLDSKLSYLRE
FYQKKLRKSSCDAILSQKDEDYLKQNQPLQEEGKTCFKQSLVTGTDVSKKNATTQNTKKK
SLSGSEGNHVKLFPKSKPVAISVASYSPMSSQDHSKNQPFDVNTSGYSPPHTADALKGPR
THRRCSEPNIEDQNRKLTYLRGIYSKKQHKTSCEAGLLHGEEDYLKRHKSLQMEGQKLIN
QSLVMGIEVGKSSATNQNTEKVLPPRLNLCPRTSYSSLSSPGTSPSGSSVSSQDSAFSQI
SEHSVFTPTETSSPIDCTFQAQRKREDLSPDFSNASHVSGMPGPSSGQACSRPAYTKKDT
MEWHSQMHSVTLHPSTWLRNGVASLKNWSLKKKAKAARPEEEKIASPKGPLEPPPHASGV
PEANSLQEEQKDLPLRAAEGLSPVQSAQRCSSSPFQDSERHCSSPFSLVESRLKLCMKSH
EEIEPGSQSSSGSLPWERASASSWTLEDATSPDSGPTVVCDIEDRYLTKDI
NT seq 3576 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgatgtccccccagcaggagactctagggggacagccggggcgctcctcttcc
ctgacaggagtgtctcggctcgcgggaggcagctgcaccaagaagaaaatgaaaacacta
gcagaaaggaggaggagcgctccatctcttatcctggataaagccctacaaaaacggcct
actaccagggacagtccttctgctagtgttgacacatgcacatttctgtcatcattagtg
tgctccaataggactctgctgattgatggccgggcagaactcaaaagaggcctccagagg
caggagcggcatcttttcctattcaatgatctgtttgttgtggccaaaatcaaatataac
aataactttaagataaaaaataaaattaaattaactgatatgtggacagcaagctgtgtg
gatgaagtgggagaaggcaacaccaatgccatgaaatcctttgttttgggctggcccaca
gtgaactttgtggccactttcagttctccagaacaaaaggacaaatggctctctctcctt
cagagatacatcaatctagagaaagaaaaggactacccgaagagcattcccctcaaaatc
ttcgccaaggacattgggaattgtgcctactctaaaactataacagtaatgaattcagat
acagcgaatgaagttatcaacatgtcattaccaatgctagggataactggctctgagaga
gattaccagttgtgggtcaattctggcaaagaagaggctccatacccactcattgggcat
gaatatccatatggaattaaaatgagccatcttcgagactctgcactcctgacaccggga
tcaaaggactctaccacccctttcaacctccaggagcccttccttatggaacagctcccc
cgagagatgcagtgccagttcatcctgaagcccagccgcctggctgcagcccagcaactg
agtgattcaggtcataagacatttaaaaggagaagatctatcataaactgggccttctgg
cgaggttctagcactcacctggacaacttgccctcatcgccaacatcacctatgccagga
cagctctttggaatttctctgccaaatatttgtgagaatgacaatctgcccaaacctgtc
ttggatatgcttttctttcttaatcaaaaaggacctctcaccaaaggtatcttcaggcaa
tcagccaatgtgaaatcctgcagagaactaaaagagaaattgaattctggagtcgaagta
cacctagactgtgaatctatttttgtgatagcatctgtcttaaaggattttctgcgaaat
attccaggaagtattttttcatcagatctctatgatcactgggtctctgtaatggatcaa
ggaaatgatgaagagaaaataaatactgttcaaaggctattagaccagcttccgagagcc
aatgttgttctcctaaggtatctttttggggtgttacacaacattgagcaacattcctca
tccaatcagatgactgcatttaatttagctgtgtgtgtcgctccaagtattctttggcct
cctgcttcctccagcccagaactagaaaacgaatttacaaaaaaggtttccctgcttata
caatttctgattgagaattgccttaggatatttggagaagaaatcacttccctcttcaga
gaggtttcagtgagatgtgacactagagagaatgcctcagatatttcttgctttcaactg
aatgactcctcctatgacagcttggaaaatgagctaaatgaggatgttgatgcaccatgc
agtgacttggtaaagaaacttggccaggggagcagaagcatggactctgtcttaaccctc
agtgactatgatcttgaccagcccgaggtggaaggccttttaaccctaagcgactttgac
ttggcccattctaaagatgaagatgttcaaatgaaacggcctcttgaatccaagccggtg
aacattttagtgtacacaaagatcccactgcgggatcatgccagggccccatctgccatg
tgcacacccagctacctgtccacagctgcagcaaatgctgcaaaaagcctgaggcgacac
cggcgttgctcagagcccagcatcgactatctggattcaaagctttcctacctcagggag
ttttatcagaaaaagctacgcaagtccagctgtgatgcaattctttctcaaaaagatgaa
gactatctgaagcagaatcaacccctccaggaggaaggaaagacatgttttaaacagagt
ttagtcacaggcactgatgtcagcaagaaaaatgccactactcaaaacactaagaagaaa
agcttgtctggtagtgaaggaaatcacgtgaaacttttccctaagtctaagccagtggcc
atttctgtggcatcttatagtcctatgtcctcacaggatcattccaagaaccagcccttt
gatgtgaatacatctggatactccccaccacacacagcagatgccctcaagggtccaagg
acacatcggcgctgctcagagcccaacatagaagaccagaaccgcaagctgacctatctc
aggggaatttattcaaagaaacaacataaaaccagctgtgaagctggtctcttgcatgga
gaggaggattatctcaaacggcataagtctttgcaaatggaggggcagaagctcattaat
cagagtttagtcatggggattgaggtgggcaagagtagtgccacaaaccaaaacactgag
aaggttttacccccaagattaaacctttgcccaaggaccagctattccagcttatcctcc
ccaggcacttccccatccggctcatcagtaagctcccaagacagtgctttttctcagatt
tctgaacactctgtgtttacacccactgagacttcctctccaatagattgcacttttcag
gctcagagaaaacgggaagacctttctcctgactttagcaatgccagccatgtttccgga
atgcccggtccctcatcagggcaggcttgcagccgcccagcctatacaaagaaggacacc
atggagtggcattcacaaatgcattctgtaactcttcatcccagcacatggttgagaaat
ggtgtggccagtttgaaaaactggtccctcaaaaagaaagcaaaggcagccagaccagag
gaagagaaaatagcttctccaaaaggacccttagagccacccccacatgcttctggtgtt
ccagaagccaactcactgcaagaggaacaaaaagacttgcccttaagggcagctgaagga
ctgtcccctgtgcagtcagcccaaaggtgtagttcttctcccttccaggactcagagaga
cactgtagctctccattcagcctggtggagagcagacttaagctgtgcatgaagtcacat
gaggaaatagagcctggtagtcagagctcttctggttctctgccttgggaaagagcctca
gccagctcttggactctagaggatgcgaccagcccagactcagggcctacagtggtctgc
gacattgaggacaggtatttaaccaaagacatttaa

DBGET integrated database retrieval system