KEGG   Homo sapiens (human): 57570
Entry
57570             CDS       T01001                                 

Symbol
TRMT5, COXPD26, KIAA1393, TRM5
Name
(RefSeq) tRNA methyltransferase 5
  KO
K15429  tRNA (guanine37-N1)-methyltransferase [EC:2.1.1.228]
Organism
hsa  Homo sapiens (human)
Disease
H00891  Combined oxidative phosphorylation deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    57570 (TRMT5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.228  tRNA (guanine37-N1)-methyltransferase
     57570 (TRMT5)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    57570 (TRMT5)
SSDB
Motif
Pfam: Met_10 Methyltransf_15 MethyltransfD12 tRNA_U5-meth_tr TRM
Other DBs
NCBI-GeneID: 57570
NCBI-ProteinID: NP_065861
OMIM: 611023
HGNC: 23141
Ensembl: ENSG00000126814
Vega: OTTHUMG00000171294
Pharos: Q32P41(Tbio)
UniProt: Q32P41
Position
14:complement(60971441..60981690)
AA seq 509 aa
MVLWILWRPFGFSGRFLKLESHSITESKSLIPVAWTSLTQMLLEAPGIFLLGQRKRFSTM
PETETHERETELFSPPSDVRGMTKLDRTAFKKTVNIPVLKVRKEIVSKLMRSLKRAALQR
PGIRRVIEDPEDKESRLIMLDPYKIFTHDSFEKAELSVLEQLNVSPQISKYNLELTYEHF
KSEEILRAVLPEGQDVTSGFSRIGHIAHLNLRDHQLPFKHLIGQVMIDKNPGITSAVNKI
NNIDNMYRNFQMEVLSGEQNMMTKVRENNYTYEFDFSKVYWNPRLSTEHSRITELLKPGD
VLFDVFAGVGPFAIPVAKKNCTVFANDLNPESHKWLLYNCKLNKVDQKVKVFNLDGKDFL
QGPVKEELMQLLGLSKERKPSVHVVMNLPAKAIEFLSAFKWLLDGQPCSSEFLPIVHCYS
FSKDANPAEDVRQRAGAVLGISLEACSSVHLVRNVAPNKEMLCITFQIPASVLYKNQTRN
PENHEDPPLKRQRTAEAFSDEKTQIVSNT
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggtgctttggatcttatggaggccatttggattctcaggaagatttctgaaactggaa
agccatagcataactgaatcaaaatcgttgattccagtagcttggacatccctgacacag
atgcttttggaagcacctggtattttcttattgggtcaaagaaaaagattctcaaccatg
ccagaaacagaaacacatgagagagagactgaattgttttcaccaccttctgatgtccga
ggcatgacaaaacttgatagaacagcttttaaaaagacagtcaacattccagtgcttaaa
gtgaggaaagaaatagtcagtaaattgatgcgatccctaaaaagggcagcattgcagcgc
ccaggcataagacgtgtgattgaagatccggaagataaagaaagtagactaatcatgttg
gatccctataaaatatttactcatgattcctttgagaaagcagaactcagtgttttagag
cagcttaatgtcagtccacagatctctaaatacaatttggaactaacatatgaacacttt
aagtcagaagaaatcttgagagctgtgcttcctgaaggtcaagatgtaacttcagggttt
agcaggattggacatattgcacacctaaaccttcgagatcatcagctgcctttcaaacat
ttaattggccaggttatgattgacaaaaatccaggaatcacctcagcagtaaataaaata
aataatattgacaatatgtaccgaaatttccaaatggaagtgctatctggagagcagaac
atgatgacaaaggttcgagaaaacaactacacctatgaatttgatttttcaaaagtctat
tggaatcctcgtctgtctacagaacacagccgtatcacagaacttctcaaacctggggat
gtcctatttgatgtttttgctggggttgggccctttgccattccagtagcaaagaaaaac
tgcactgtatttgccaatgatctcaatcctgaatctcataaatggctgttgtacaactgt
aaattaaataaagtggaccaaaaggtgaaagtcttcaacttggatgggaaagacttcctc
caaggaccagtcaaagaagagttaatgcagctgctgggtctgtcaaaagaaagaaaaccc
tctgtgcacgttgtcatgaacttgccagcaaaagctatagagtttcttagtgctttcaag
tggcttttagatgggcagccatgcagcagtgagttccttcccatagtgcattgttatagc
ttttccaaagatgctaaccctgctgaggatgttcggcaaagggctggagctgtgttaggc
atttctctggaggcatgcagttcagttcacctggtaagaaatgtggccccaaacaaggaa
atgctgtgcatcacgtttcagattcctgcctctgtcctctacaagaaccagaccagaaat
ccagagaatcatgaagatccacctcttaaaaggcagaggacggctgaagccttttcagac
gaaaaaacacaaattgtttcaaacacttaa

DBGET integrated database retrieval system