KEGG   Homo sapiens (human): 57571Help
Entry
57571             CDS       T01001                                 

Gene name
CARNS1, ATPGD1
Definition
(RefSeq) carnosine synthase 1
  KO
K14755  carnosine synthase [EC:6.3.2.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00330  Arginine and proline metabolism
hsa00340  Histidine metabolism
hsa00410  beta-Alanine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    57571 (CARNS1)
   00340 Histidine metabolism
    57571 (CARNS1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    57571 (CARNS1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.11  carnosine synthase
     57571 (CARNS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATPgrasp_N ATPgrasp_Ter ATP-grasp_4 ATP-grasp_3 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 57571
NCBI-ProteinID: NP_065862
OMIM: 613368
HGNC: 29268
Ensembl: ENSG00000172508
Vega: OTTHUMG00000167672
Pharos: A5YM72(Tbio)
UniProt: A5YM72
Position
11q13.2
AA seq 827 aa AA seqDB search
MLLCLSPAWLMKVPAPGQPGEAALLVSKAVSFHPGGLTFLDDFVPPRRATYFLAGLGLGP
GRGREAAELARDLTCPTGASAELARLLEDRLLTRQLLAQQGGVAVPATLAFTYKPPGLLR
GGDASLGLRLVELSGKEGQETLVKEEVEAFLRSEALGDILQVAVKLSGWRWRGRQAWRLH
PRAELGAVVDTVLALLEKLEEEESVLVEAVYPPAQLPCSDGPSPGPGLAVRICAVVCRTQ
GDRPLLSKVVCGVGRGDRPLRHHNSLPRTLEVALAQCGLGEEAQVAAVRQRVKAAAEAAL
AAVLALEAGLSAEQRGGRRAHTDFLGVDFALTAAGGVLTPVALELNGGLCLEACGALEGL
WAAPRLGPAADEAVAAPLVETMLRRSARCLMEGKQLLVVGAGGVSKKFVWEAARDYGLQL
HLVESDPNHFASQLVQTFIHFDMTEHRRDEENARLLAELVRARGLKLDGCFSYWDDCLVL
TALLCQELGLPCSSPAAMRLAKQKSLTQLHLLHHHGPPWPAPSLHAVPCCPLESEADVER
AVHQVPLPGVMKLEFGAGAVGVRLVEDAPQCHEHFSRITRDLQGEADHPGIGLGWGNAML
LMEFVEGTEHDVDLVLFGGRLLAAFVSDNGPTRLPGFTETAACMPTGLAPEQEAQMVQAA
FRCCLGCGLLDGVFNVELKLTGAGPRLIEINPRMGGFYLRDWILELYGVDLLLAAVMVAC
GLRPALPTRPRARGHLVGVMCLVSQHLQALSSTASRETLQALHDRGLLRLNLLEEALVPG
EYEEPYCSVACAGPSPTEARLRLLGLCQGLGIDGPSYPVAHFLSHFK
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgctcctttgcctgtcccctgcttggctgatgaaggtgccagcacccgggcagccgggt
gaggcagccctgctagtctccaaggctgtgagcttccaccctgggggcctgacattcctg
gatgactttgtccccccgcgccgtgccacctactttttggcaggcctgggcctggggcct
ggccggggccgagaggcagcagaactcgcccgtgacctgacctgccccacaggagcttcg
gctgagctggcccggctgctggaggaccggctgctgacaaggcagttgctggcccagcag
ggtggtgtggctgtgccagcaaccctggctttcacctacaagccgccggggctgctgcgg
ggaggggatgccagcctagggctacggctggtggagctgagtggcaaagagggccaggag
acgctggtgaaagaggaagtggaggcttttctgcgctccgaggccctgggtgatatcctg
caggtagctgtgaagctcagtggctggcgctggcgggggcggcaggcatggcgtctgcac
ccgcgggcagagctgggtgcagtggtggacacagtgctggcgctgctggagaagctggag
gaggaggagagtgtcctggtggaggctgtgtacccacctgcccagctgccctgctcagat
ggtccttcacccggccccggcctggccgtgcgaatctgtgctgtggtgtgtcggacacag
ggtgataggccactgctgagcaaggtggtgtgcggcgtgggccgcggggaccgccctcta
cggcaccacaactccctgccgaggacgctggaggtggcgctggcccagtgcggcctgggc
gaggaggcgcaggtggcggctgtgcggcagcgcgtcaaggcggcggccgaggccgcgctg
gccgccgtgctggctctggaggccggcctgagtgccgagcagcgcggcgggcgccgggcg
cacacggacttcctgggcgtggatttcgcgctgacagcggccggcggcgtgctgacccca
gtggccctggagctgaacggcggcctgtgtctggaggcgtgcggcgcgctggaggggctg
tgggccgcgccgcggctggggccggcggccgacgaggcggtggcggcgccgctggtggag
accatgcttcggcggtcggcgcgctgcctcatggagggaaaacagctgctggtggtcggc
gctggcggcgtcagcaagaagttcgtgtgggaggcggcgcgcgactacgggctccagctg
cacctcgtggagtcagaccccaaccactttgcatcccagttggtacagaccttcatccac
tttgacatgacagagcaccggagggatgaggagaacgcacggctgctggcagagttggtg
cgggctcgcggcctcaagctagatggctgcttctcctactgggatgactgcctggtgctc
acagccctgctctgccaggagctaggtctgccctgcagctccccagctgccatgcgcctg
gctaagcagaagagcctcacccagctgcacctgttgcaccaccatggcccaccctggcct
gcgccctccctccatgctgtgccctgctgcccactggagagtgaggctgatgtggagagg
gccgtgcaccaggtacccctgccaggtgtcatgaagctggagttcggggcaggtgcagtg
ggtgtccggctggtagaggatgcgccacagtgccatgagcacttttcccggattacccga
gacttgcagggcgaggccgaccacccaggcattgggctgggctggggcaatgccatgctg
ctgatggagtttgtggagggcaccgagcacgacgtggacctggtgttgtttggtgggcgg
ttgctggctgcctttgtctccgacaatggccctacgaggctgcctggcttcactgagacg
gcggcctgcatgcccaccgggctggcaccagagcaggaggcacagatggttcaggcagcc
ttccgctgttgcctgggctgcgggttgctcgatggagtcttcaacgtggagctcaagctg
accggggctgggcctcggcttatcgagatcaacccccgcatgggtggcttctacctgcgt
gattggatcctggagctctatggtgttgacctgctgctggctgctgttatggtggcctgt
ggcttgcgtcctgccctgcccacccgcccacgtgctcgtggccatctggtgggcgtcatg
tgccttgtgtcccagcacctgcaggccctgagttccaccgccagccgtgagaccctgcag
gccctgcacgaccgtggactgctacgcctcaatctgctggaggaggccctggtgcctggc
gagtatgaggagccctactgcagtgtggcctgtgccggacccagccccaccgaggcccgt
ctccgcctgctgggcctctgccagggcctgggcatcgatgggcccagctaccctgttgcc
cacttcctgtctcacttcaaatag

DBGET integrated database retrieval system