KEGG   Homo sapiens (human): 57573
Entry
57573             CDS       T01001                                 

Gene name
ZNF471, ERP1, Z1971, Zfp78
Definition
(RefSeq) zinc finger protein 471
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    57573 (ZNF471)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    57573 (ZNF471)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    57573 (ZNF471)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz Zn-ribbon_8 XPA_N zf-C2H2_6 zinc_ribbon_15 zf-H2C2_5 C1_4 Siva
Other DBs
NCBI-GeneID: 57573
NCBI-ProteinID: NP_065864
HGNC: 23226
Ensembl: ENSG00000196263
Vega: OTTHUMG00000181943
Pharos: Q9BX82(Tdark)
UniProt: Q9BX82 A0A024R4Q9
Position
19q13.43
AA seq 626 aa
MNVEVVKVMPQDLVTFKDVAIDFSQEEWQWMNPAQKRLYRSMMLENYQSLVSLGLCISKP
YVISLLEQGREPWEMTSEMTRSPFSDWESIYVTQELPLKQFMYDDACMEGITSYGLECST
FEENWKWEDLFEKQMGSHEMFSKKEIITHKETITKETEFKYTKFGKCIHLENIEESIYNH
TSDKKSFSKNSMVIKHKKVYVGKKLFKCNECDKTFTHSSSLTVHFRIHTGEKPYACEECG
KAFKQRQHLAQHHRTHTGEKLFECKECRKAFKQSEHLIQHQRIHTGEKPYKCKECRKAFR
QPAHLAQHQRIHTGEKPYECKECGKAFSDGSSFARHQRCHTGKRPYECIECGKAFRYNTS
FIRHWRSYHTGEKPFNCIDCGKAFSVHIGLILHRRIHTGEKPYKCGVCGKTFSSGSSRTV
HQRIHTGEKPYECDICGKDFSHHASLTQHQRVHSGEKPYECKECGKAFRQNVHLVSHLRI
HTGEKPYECKECGKAFRISSQLATHQRIHTGEKPYECIECGNAFKQRSHLAQHQKTHTGE
KPYECNECGKAFSQTSNLTQHQRIHTGEKPYKCTECGKAFSDSSSCAQHQRLHTGQRPYQ
CFECGKAFRRKLSLICHQRSHTGEEP
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgaatgttgaagtagtaaaagtcatgccccaggacttagtgacattcaaggatgtggca
atagatttttcccaggaagaatggcaatggatgaaccctgctcagaagcgtttatacagg
agtatgatgttggagaactatcagagcctggtatcacttggtctttgcatttctaagcca
tatgtgatctccttattggagcaagggagagagccttgggagatgacgagtgagatgaca
agaagcccattctcagattgggaatctatatatgtgacacaggaattacctctgaagcag
ttcatgtatgatgatgcatgcatggagggaattactagctatggacttgagtgttccact
tttgaagaaaattggaaatgggaagacctttttgagaagcagatgggaagtcatgagatg
tttagcaagaaagaaataatcactcataaagaaaccatcactaaggaaacagaattcaaa
tatactaaatttgggaaatgtatccatctggaaaacatagaagagagtatttataatcac
acatcagataaaaaaagcttctccaaaaattctatggtaataaaacacaagaaagtctat
gtaggaaagaagctttttaaatgtaatgaatgtgacaaaaccttcacccatagctcatcc
cttactgttcattttagaattcatactggtgaaaaaccatatgcatgtgaggaatgtgga
aaagccttcaagcaaaggcaacaccttgctcaacatcacagaacacatactggagagaaa
ctctttgaatgtaaagaatgtaggaaagccttcaaacaaagtgaacaccttattcagcat
caaagaattcatactggagaaaaaccatataaatgtaaggaatgcagaaaagccttcaga
cagcctgcacaccttgctcagcatcagagaattcatactggagagaaaccctatgaatgt
aaagaatgtggcaaagccttcagtgatggctcgtcttttgctcgacatcagagatgtcac
actggcaaaagaccctatgaatgtattgagtgtgggaaggcttttaggtataacacatct
tttattcgtcactggaggagttatcatactggagagaagccttttaattgcattgattgt
gggaaagccttcagtgttcacataggacttattctgcataggagaattcatacaggagag
aaaccttacaaatgtggtgtgtgtggaaaaaccttcagctcgggttcatcccgtactgta
catcagagaattcatacaggagagaaaccttatgaatgtgatatatgtgggaaagatttt
agccatcatgcatcactcactcagcatcaaagagtacattctggagagaaaccgtatgaa
tgcaaggaatgtgggaaagcctttaggcagaatgtacaccttgttagtcatttgagaatt
catactggtgaaaaaccctatgaatgtaaagaatgtggaaaagcttttagaatcagttca
cagctggctactcatcagagaattcatactggagagaagccttatgaatgtattgaatgt
ggaaatgctttcaaacagagatcacaccttgcccaacatcagaaaactcatacaggagag
aaaccttatgagtgtaatgaatgcgggaaagccttcagccaaacttccaatcttactcaa
catcaaagaattcatactggagagaaaccctataaatgtactgaatgtggaaaggctttt
agtgatagctcatcctgtgctcagcatcaaagactccacactggccaaaggccctatcag
tgttttgaatgtgggaaggcgttcagaagaaagttatccttaatttgtcatcaaagaagt
catactggagaagaaccttaa

DBGET integrated database retrieval system