KEGG   Homo sapiens (human): 57580Help
Entry
57580             CDS       T01001                                 

Gene name
PREX1, P-REX1
Definition
(RefSeq) phosphatidylinositol-3,4,5-trisphosphate dependent Rac exchange factor 1
  KO
K12365  phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchanger 1 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
N00153  CXCR-GNB/G-PI3K-RAC signaling pathway
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    57580 (PREX1)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    57580 (PREX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF DEP PDZ_6 PDZ PH PH_10 IQ_SEC7_PH
Motif
Other DBs
NCBI-GeneID: 57580
NCBI-ProteinID: NP_065871
OMIM: 606905
HGNC: 32594
Ensembl: ENSG00000124126
Vega: OTTHUMG00000032685
Pharos: Q8TCU6(Tbio)
UniProt: Q8TCU6
Structure
PDB: 

Position
20q13.13
AA seq 1659 aa AA seqDB search
MEAPSGSEPGGDGAGDCAHPDPRAPGAAAPSSGPGPCAAARESERQLRLRLCVLNEILGT
ERDYVGTLRFLQSAFLHRIRQNVADSVEKGLTEENVKVLFSNIEDILEVHKDFLAALEYC
LHPEPQSQHELGNVFLKFKDKFCVYEEYCSNHEKALRLLVELNKIPTVRAFLLSCMLLGG
RKTTDIPLEGYLLSPIQRICKYPLLLKELAKRTPGKHPDHPAVQSALQAMKTVCSNINET
KRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFLFDNLLVY
CKRKSRVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWK
IHNTAKNKWFVCMAKTAEEKQKWLDAIIREREQRESLKLGMERDAYVMIAEKGEKLYHMM
MNKKVNLIKDRRRKLSTVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVS
DKHQFKNEQVMYRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLYTPVIKDRDYHLKTYK
SVLPGSKLVDWLLAQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFRDESQYFRFHADEE
MEGTSSKNKQLRNDFKLVENILAKRLLILPQEEDYGFDIEEKNKAVVVKSVQRGSLAEVA
GLQVGRKIYSINEDLVFLRPFSEVESILNQSFCSRRPLRLLVATKAKEIIKIPDQPDTLC
FQIRGAAPPYVYAVGRGSEAMAAGLCAGQCILKVNGSNVMNDGAPEVLEHFQAFRSRREE
ALGLYQWIYHTHEDAQEARASQEASTEDPSGEQAQEEDQADSAFPLLSLGPRLSLCEDSP
MVTLTVDNVHLEHGVVYEYVSTAGVRCHVLEKIVEPRGCFGLTAKILEAFAANDSVFVEN
CRRLMALSSAIVTMPHFEFRNICDTKLESIGQRIACYQEFAAQLKSRVSPPFKQAPLEPH
PLCGLDFCPTNCHINLMEVSYPKTTPSVGRSFSIRFGRKPSLIGLDPEQGHLNPMSYTQH
CITTMAAPSWKCLPAAEGDPQGQGLHDGSFGPASGTLGQEDRGLSFLLKQEDREIQDAYL
QLFTKLDVALKEMKQYVTQINRLLSTITEPTSGGSCDASLAEEASSLPLVSEESEMDRSD
HGGIKKVCFKVAEEDQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGS
GDELPCDMRIPSDKQDKLHGCLEHLFNQVDSINALLKGPVMSRAFEETKHFPMNHSLQEF
KQKEECTIRGRSLIQISIQEDPWNLPNSIKTLVDNIQRYVEDGKNQLLLALLKCTDTELQ
LRRDAIFCQALVAAVCTFSEQLLAALGYRYNNNGEYEESSRDASRKWLEQVAATGVLLHC
QSLLSPATVKEERTMLEDIWVTLSELDNVTFSFKQLDENYVANTNVFYHIEGSRQALKVI
FYLDSYHFSKLPSRLEGGASLRLHTALFTKVLENVEGLPSPGSQAAEDLQQDINAQSLEK
VQQYYRKLRAFYLERSNLPTDASTTAVKIDQLIRPINALDELCRLMKSFVHPKPGAAGSV
GAGLIPISSELCYRLGACQMVMCGTGMQRSTLSVSLEQAAILARSHGLLPKCIMQATDIM
RKQGPRVEILAKNLRVKDQMPQGAPRLYRLCQPPVDGDL
NT seq 4980 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgcccagcggcagcgagcccggcggcgacggggccggggactgcgcccacccg
gacccccgggcccctggcgccgcggcgcccagctccggccccggcccgtgcgcggccgcc
cgggagtccgagcgccagctgcgcctccgcctctgcgtcctcaacgagatcttgggcacc
gagagggactacgtgggcaccttgcgcttcttgcagtcggcattcctgcatcgcatccgg
cagaacgtggccgactcagtggagaagggcctcacggaggagaatgtcaaggtcctgttc
tcgaacatcgaagacatcctggaagttcataaggatttcttggccgccttggagtattgt
ttacacccggagccgcagtctcagcatgaacttgggaatgttttcttaaaattcaaggac
aagttctgcgtgtacgaggagtattgcagcaaccatgagaaagccctgaggctgctggtg
gagctgaacaagatccctaccgtgcgcgccttccttttgagctgcatgcttctgggaggc
cggaagaccacggacatccctttggaaggctacctgttgtctccgatccagaggatctgc
aagtacccgctcctccttaaggagctggccaagaggactcccggcaagcacccagaccac
cccgcggtccagagtgccctgcaggccatgaagaccgtttgctccaacatcaatgagacc
aagcggcagatggagaagctggaagccctggagcagctgcagtcccacatcgaaggctgg
gagggttccaacctcacagacatctgcactcagctcctcctgcaagggactttgttaaag
atctctgcgggcaacatccaggaaagggccttcttcctcttcgacaaccttctcgtctac
tgcaagcggaaatccagggtcaccgggagcaagaagtccaccaagaggaccaaatccatc
aacggctccctctacatcttcaggggtcgaatcaacactgaagtcatggaggtggagaat
gtggaagatgggacagcggattaccatagcaacggctataccgtcaccaacggctggaag
atccacaacacggccaagaataagtggtttgtctgcatggccaagacggcagaggagaag
cagaagtggctggatgccatcatccgcgagcgggagcagcgcgagagcctgaagctgggc
atggagcgtgatgcctacgtcatgattgcggagaagggggagaagctgtaccacatgatg
atgaacaagaaggtgaacctcatcaaggaccgccggagaaagctgagcactgtccccaag
tgctttcttggcaatgagttcgttgcctggctcctagaaattggtgaaatcagcaagacg
gaagaaggagtcaacttgggccaagccctgttggagaatggcatcatccaccatgtttcc
gacaagcaccagttcaagaatgagcaggtgatgtatcgcttccgctacgacgatggcacc
tacaaggcccgaagtgagctggaggacatcatgtccaagggtgtgaggctttactgccgt
cttcacagcctctacaccccggtgatcaaagaccgtgattaccacctgaagacctacaag
tcagtgcttcccgggagcaagctggtggactggctgctggctcagggagactgccagact
cgggaggaggcagtggcgctcggcgtgggtctgtgcaacaatggcttcatgcaccacgtg
ctggagaagagcgagttcagggatgagtcccagtacttccgctttcatgctgacgaggag
atggaggggaccagcagcaagaacaaacagcttcgcaacgacttcaagctggtggagaac
attctggccaagcgcctgctgatcctgccccaggaggaggactatggctttgacatcgag
gagaagaacaaggctgtggtggtgaagtccgtccagaggggctcgctggctgaggtggct
ggcctgcaggtggggaggaagatctactccatcaatgaggacctggtgttcctgcggccg
ttttcagaggtggagtccatcctcaaccagtccttctgctcccgccgccctctgcgcctc
ctggtggccacgaaggccaaagagatcatcaaaatccccgaccagccggacacactgtgc
ttccagattcgtggagctgccccaccgtacgtctatgctgtggggagaggctctgaggcc
atggctgcagggctctgtgctggtcagtgcattctgaaggtcaatggcagcaacgtgatg
aacgatggtgcccctgaggtcctggagcacttccaggcattccggagtcggcgcgaagag
gccctgggcctgtaccagtggatctaccacacccatgaggatgcccaggaagcacgagcc
agtcaggaggcctccactgaggaccccagtggcgagcaggcccaggaggaagaccaggct
gattcagccttcccactgctgtccctgggtccccggctgagcctgtgtgaggacagcccc
atggtcaccctgactgtggacaacgtgcacctggaacacggcgtggtgtatgagtatgtg
agcacggcaggcgtcaggtgccatgtgctggagaagatcgtggagccccgcggctgcttc
ggcctcaccgccaagatcctcgaggcctttgctgccaatgacagcgtcttcgtggagaac
tgcaggcggctcatggccctgagcagcgccatcgtgaccatgccccactttgagttccgc
aacatctgtgacaccaagctggagagcattggccagaggattgcctgctaccaggagttt
gcagcccaactgaagagcagggtcagcccacccttcaaacaagcccccctggagccccac
ccgctgtgtggcctggacttctgccccaccaattgccacatcaacctcatggaagtgtcc
taccccaagaccaccccctcagtgggcaggtccttcagcatccgctttggacgcaaaccc
tccctcatcggccttgacccggagcaaggccacctgaaccccatgtcgtacacccagcac
tgcatcaccaccatggctgctccctcctggaagtgcttgcctgctgcagagggtgatccc
caaggccagggtctccatgatggcagcttcgggccagccagtgggacccttggtcaggaa
gaccggggcctcagcttcctactcaagcaggaggaccgtgagatccaggatgcctacctg
cagctcttcaccaagctggatgtggccctgaaggagatgaagcaatatgtcacccagatc
aacaggctgctgtccaccatcacagagcccacctcgggtgggtcctgcgacgcatccttg
gctgaggaggcctcctccctgcccctggtcagtgaagagagcgagatggacaggagtgac
catgggggcatcaagaaggtgtgcttcaaggtggccgaggaggaccaggaggactcaggc
cacgacaccatgagttatcgcgactcctacagcgagtgtaacagcaatcgagactcggtc
ctgtcctacaccagcgtgagaagtaacagctcctacttgggcagcgacgagatggggtct
ggagatgagctgccctgtgacatgcggatcccatctgacaagcaggacaagcttcatggc
tgcctggagcacctctttaaccaggtggactccatcaatgctctcctcaaggggccagtc
atgagccgggctttcgaagagaccaagcatttccctatgaaccacagcttacaagagttt
aaacagaaagaagagtgtacaatccgtggccggagcctgatccagattagcatccaggag
gacccctggaacctccccaactccatcaagaccctggtggacaacattcagagatatgtg
gaagatgggaagaaccagctgctcctggccttgctgaagtgcacagacacggagctgcag
ctgcgcagagacgcgatcttctgccaggccctggtggccgccgtgtgcaccttctccgag
cagctgctggcggccctgggctaccgctacaacaacaatggcgagtacgaggagagcagc
cgcgacgccagccgcaagtggctggagcaggtggcggccacgggcgtcctgctgcactgc
cagtccctgctctcgccagccacagtgaaggaggaacggaccatgctggaggacatctgg
gtgacgctgtcagagctggacaatgtcaccttctcctttaagcagctggacgagaactat
gtggccaacaccaacgtcttctaccacattgagggcagccggcaggcgctgaaggtcatc
ttctacctcgacagctaccacttctccaagctgccctcccgcctggagggtggggccagc
ctgaggctgcacacagcgctgttcacgaaagtgctggagaacgtggaggggctgccttct
ccaggcagccaggccgcggaggatttgcagcaggacatcaacgcgcagtccctggagaaa
gttcagcagtattaccgcaaactcagggcattttacctggagcggtctaacctgcccacg
gatgccagcaccacggcggtaaagatagaccagctgatccgccccatcaatgccctggat
gagctctgccgcctcatgaagtcctttgtccacccaaagcctggtgctgctgggagtgtg
ggcgccggcctcatccccatctcctcggagctctgctaccgcctgggggcctgccagatg
gtcatgtgtggcacaggcatgcagaggagcaccctgagcgtgtccctggagcaggcggcc
atcttggcacggagccacgggttgctgcccaagtgcatcatgcaggccacggacatcatg
cggaagcagggcccaagggtggagattctggccaaaaacctgcgagtcaaggaccagatg
ccccagggtgctccgcgcctctaccgcctctgccagccgccggtggatggggacctctga

DBGET integrated database retrieval system