KEGG   Homo sapiens (human): 57589Help
Entry
57589             CDS       T01001                                 

Gene name
RIC1, CIP150, KIAA1432, bA207C16.1
Definition
(RefSeq) RIC1 homolog, RAB6A GEF complex partner 1
  KO
K20476  RAB6A-GEF complex partner protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    57589 (RIC1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab associated proteins
    57589 (RIC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RIC1
Motif
Other DBs
NCBI-GeneID: 57589
NCBI-ProteinID: NP_065880
OMIM: 610354
HGNC: 17686
Ensembl: ENSG00000107036
Vega: OTTHUMG00000019505
Pharos: Q4ADV7(Tbio)
UniProt: Q4ADV7
Position
9p24.1
AA seq 1423 aa AA seqDB search
MYFLSGWPKRLLCPLGSPAEAPFHVQSDPQRAFFAVLAAARLSIWYSRPSVLIVTYKEPA
KSSTQFGSYKQAEWRPDSTMIAVSTANGYILFFHITSTRGDKYLYEPVYPKGSPQMKGTP
HFKEEQCAPALNLEMRKILDLQAPIMSLQSVLEDLLVATSDGLLHLIHWEGMTNGRKAIN
LCTVPFSVDLQSSRVGSFLGFTDVHIRDMEYCATLDGFAVVFNDGKVGFITPVSSRFTAE
QLHGVWPQDVVDGTCVAVNNKYRLMAFGCVSGSVQVYTIDNSTGAMLLSHKLELTAKQYP
DIWNKTGAVKLMRWSPDNSVVIVTWEYGGLSLWSVFGAQLICTLGGDFAYRSDGTKKDPL
KINSMSWGAEGYHLWVISGFGSQNTEIESDLRSVVKQPSILLFQFIKSVLTVNPCMSNQE
QVLLQGEDRLYLNCGEASQTQNPRSSSTHSEHKPSREKSPFADGGLESQGLSTLLGHRHW
HVVQISSTYLESNWPIRFSAIDKLGQNIAVVGKFGFAHYSLLTKKWKLFGNITQEQNMIV
TGGLAWWNDFMVLACYNINDRQEELRVYLRTSNLDNAFAHVTKAQAETLLLSVFQDMVIV
FRADCSICLYSIERKSDGPNTTAGIQVLQEVSMSRYIPHPFLVVSVTLTSVSTENGITLK
MPQQARGAESIMLNLAGQLIMMQRDRSGPQIREKDSNPNNQRKLLPFCPPVVLAQSVENV
WTTCRANKQKRHLLEALWLSCGGAGMKVWLPLFPRDHRKPHSFLSQRIMLPFHINIYPLA
VLFEDALVLGAVNDTLLYDSLYTRNNAREQLEVLFPFCVVERTSQIYLHHILRQLLVRNL
GEQALLLAQSCATLPYFPHVLELMLHEVLEEEATSREPIPDPLLPTVAKFITEFPLFLQT
VVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQNMEVPAVSRQHAT
LLFNTALEQGKWDLCRHMIRFLKAIGSGESETPPSTPTAQEPSSSGGFEFFRNRSISLSQ
SAENVPASKFSLQKTLSMPSGPSGKRWSKDSDCAENMYIDMMLWRHARRLLEDVRLKDLG
CFAAQLGFELISWLCKERTRAARVDNFVIALKRLHKDFLWPLPIIPASSISSPFKNGKYR
TVGEQLLKSQSADPFLNLEMDAGISNIQRSQSWLSNIGPTHHEIDTASSHGPQMQDAFLS
PLSNKGDECSIGSATDLTESSSMVDGDWTMVDENFSTLSLTQSELEHISMELASKGPHKS
QVQLRYLLHIFMEAGCLDWCIVIGLILRESSIINQILVITQSSEVDGEMLQNIKTGLHAV
DRWASTDCPGYKPFLNIIKPQLQKLSEITEEQVQPDAFQPITMGKTPEQTSPRAEESRGS
SSHGSIPQGEVGSSNMVSRKEEDTAQAEEEEPFQDGTYDCSVS
NT seq 4272 nt NT seq  +upstreamnt  +downstreamnt
atgtattttctgagcggctggcccaagaggctgctgtgccctctggggagcccggccgag
gcgcctttccacgttcagtccgacccgcagagggctttcttcgccgtgctggccgcggcc
cgcctcagcatctggtacagccgacctagtgtgttaattgtaacctacaaggagcctgca
aaatcatctactcagtttggatcctacaagcaagctgaatggaggccagatagtaccatg
atagctgtatcaacggcaaatggatacatcttgttttttcatattacatctacaagaggg
gacaagtacctttatgaaccagtgtatcccaaaggaagtccacaaatgaaggggacaccc
cattttaaggaagaacagtgtgctccagcattaaatttggagatgaggaaaatactggat
ttacaagcacccatcatgagtttgcagtctgtgttggaagatctcctggttgctacttct
gatggacttcttcatcttattcactgggaaggaatgacaaatggaaggaaagccattaat
ctttgcacagtacccttttcagtagacctgcagtcatctagagtaggttcattcctgggc
ttcacagacgtacacatcagagacatggaatactgtgccacacttgatgggtttgctgtt
gtatttaatgatggtaaagttggatttattacaccagtgtcaagtagatttactgcagag
cagcttcatggagtttggccacaagatgttgttgacggaacgtgtgtagcagtaaataac
aagtatcgactaatggcatttggctgtgtgagtggttctgtgcaggtctatacaatagat
aacagcactggagccatgctgctatctcataaattagagctaacagcaaaacagtatcct
gacatttggaataaaacaggagctgttaaattgatgagatggtctcctgacaatagtgtt
gtaatagtgacctgggaatacggaggcctttctttatggagtgtttttggagcacagctg
atttgtacacttggaggagattttgcttataggtctgatggcaccaaaaaagatcccctt
aagatcaactctatgagctggggtgcagaaggctatcacctatgggtaatcagcggattt
ggttctcaaaacactgaaattgagtctgacctcaggagtgtagttaaacagcccagcatc
ctgttatttcagtttattaagagtgtactcactgtaaacccttgtatgagtaaccaagag
caggtgttgcttcagggtgaggatcgcttgtacttgaactgtggagaggcttcacaaacc
cagaatcccaggagttcttcaacacactctgagcataagcccagtcgagaaaagagccca
tttgcagatggaggtttagagtctcagggattaagcactttacttggacatcggcattgg
catgttgtacagatttccagcacctatctagagagcaattggcctatacggttttcagct
attgataagcttggacagaatattgctgtggttggcaagtttggttttgcacattactct
ttactcaccaaaaaatggaaactttttggaaacattacccaggagcaaaatatgatcgtg
acaggtggcttagcctggtggaatgattttatggtccttgcgtgttataacataaatgac
cgtcaagaagagcttagagtatacttgcgaacatcaaatctggacaatgcctttgctcat
gtcaccaaagcacaagcagaaacattactgcttagtgtcttccaggacatggtaatagta
tttagagcagactgttcaatatgcctttacagtattgaaagaaaatctgatggtccaaat
actactgctggtattcaagttcttcaggaggtttccatgtcacgctacattcctcaccct
ttcctggtggtatctgtcactctgacatcagtgagtacagagaatggaatcaccttgaaa
atgccacagcaggctcgtggtgcagagagcattatgttaaacctggcaggacagctcatc
atgatgcagagggacaggtcaggcccacagatccgggagaaggacagtaaccctaataac
caaaggaaacttctgccattctgtcctcctgttgtactagcccagtctgttgaaaatgtc
tggacaacgtgtcgagcaaataaacagaaacgtcaccttctggaggccctctggctgagc
tgtggtggtgcagggatgaaagtttggctccctctcttccctagggatcaccgcaagccc
cattccttcttgtcccagcggatcatgctgcctttccacatcaacatttacccgctagct
gttctgtttgaagatgctttagtccttggtgctgtcaatgacactttgctctatgattct
ttatatactcggaacaatgctagagaacagctggaggtgctcttccctttctgtgttgtg
gagagaacctctcagatctacctccaccacattctacgtcaacttctggtcagaaacctt
ggggagcaagccttgctcttggcccagtcctgtgccacattaccttacttccctcatgtg
ctggagctcatgctccatgaagtactggaagaagaagctacctcacgggagcccattccc
gaccctctgcttcccactgtggcaaaatttatcactgagttccccctcttcctgcagaca
gttgtccattgtgccaggaagaccgaatatgccctgtggaattacctttttgcagctgtt
ggaaaccctaaggacttgtttgaggagtgtttgatggctcaggatttggacacagctgcc
tcttaccttattatcttacagaatatggaagtccctgcagtaagtaggcaacatgctacc
cttctattcaacacagcactagaacaaggcaagtgggacctttgtcgacacatgattcga
tttcttaaagccattggctctggagaatctgagacacctccatccacacccacagctcag
gaacccagttcaagtggtggatttgagttcttcaggaatcgaagcatcagtttatcccag
tcagctgaaaatgttcctgccagtaaattcagtttacagaaaacactaagtatgccatct
ggtccctctggaaaaagatggagcaaagacagtgactgtgctgagaacatgtatattgac
atgatgctctggagacatgctcggcgcctcttagaagatgtgaggttaaaggaccttggc
tgctttgcagcccagctgggctttgaactaattagttggctatgcaaggaacgtacccga
gccgcccgggtagacaactttgtaatagccctgaagagactccacaaagatttcctgtgg
ccacttccaatcatcccagcctcttctatcagttctcctttcaaaaatggaaaataccga
actgtgggagagcagctgttaaagtctcaatcagctgacccatttttgaaccttgagatg
gatgctggcatctccaacatccagcgaagtcagagctggctcagcaacattggccccacc
catcatgagatagacacagcttcatcccatggaccacaaatgcaagatgccttcttgtca
cctttatctaataaaggtgatgaatgcagtattggttcagccacagacttgactgaaagt
agctccatggtggatggcgactggacaatggtggatgaaaatttctctacactcagttta
actcagtcagagctggagcacatttccatggagttggccagtaaagggcctcataaatcc
caggtccagcttcggtatttgctacacattttcatggaggcagggtgcctagactggtgc
atcgttataggcctgattcttagagaatcctcaataatcaatcagattttggttattaca
cagtcttcagaggtagatggagagatgttacagaacataaagacagggctccatgcagtg
gaccgatgggcctctacagactgtcctggatataagccatttttaaacatcattaagcca
caactgcagaagctcagtgagataacagaagagcaggtccagccagatgccttccaacca
ataactatgggtaagactccagaacagactagcccccgggcagaggagagcaggggctcc
tccagccatggaagcatcccccagggtgaagttggaagcagcaatatggtcagccggaaa
gaggaggacacagcccaagcagaggaggaagaaccttttcaggatgggacttacgactgt
tctgtgtcctaa

DBGET integrated database retrieval system