KEGG   Homo sapiens (human): 57590
Entry
57590             CDS       T01001                                 

Gene name
WDFY1, FENS-1, FENS1, WDF1, ZFYVE17
Definition
(RefSeq) WD repeat and FYVE domain containing 1
  KO
K23299  WD repeat and FYVE domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    57590 (WDFY1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    57590 (WDFY1)
Motif
Pfam: WD40 FYVE ANAPC4_WD40 ELYS-bb Barwin
Other DBs
NCBI-GeneID: 57590
NCBI-ProteinID: NP_065881
OMIM: 618080
HGNC: 20451
Ensembl: ENSG00000085449
Vega: OTTHUMG00000153370
Pharos: Q8IWB7(Tbio)
UniProt: Q8IWB7 A0A024R488 Q9H8N9
Position
2q36.1
AA seq 410 aa
MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRVWLKRDSGQYW
PSIYHTMASPCSAMAYHHDSRRIFVGQDNGAVMEFHVSEDFNKMNFIKTYPAHQNRVSAI
IFSLATEWVISTGHDKCVSWMCTRSGNMLGRHFFTSWASCLQYDFDTQYAFVGDYSGQIT
LLKLEQNTCSVITTLKGHEGSVACLWWDPIQRLLFSGASDNSIIMWDIGGRKGRTLLLQG
HHDKVQSLCYLQLTRQLVSCSSDGGIAVWNMDVSREEAPQWLESDSCQKCEQPFFWNIKQ
MWDTKTLGLRQHHCRKCGQAVCGKCSSKRSSYPVMGFEFQVRVCDSCYDSIKDEDRTSLA
TFHEGKHNISHMSMDIARGLMVTCGTDRIVKIWDMTPVVGCSLATGFSPH
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggcggccgaaatccactccaggccgcagagcagccgcccggtgctgctgagcaagatc
gaggggcaccaggacgccgtcacggccgcgctgctcatccccaaggaggacggcgtgatc
acggccagcgaggacagaaccatccgggtatggctgaaaagagacagtggtcaatactgg
cccagcatttaccacacaatggcctctccttgctctgctatggcttaccatcatgacagc
agacggatatttgtgggccaggataatggagctgtaatggaatttcacgtttctgaagat
tttaataaaatgaactttatcaagacctacccagctcatcagaaccgggtgtctgcgatt
atcttcagcttggccacagagtgggtgatcagtaccggccacgacaagtgtgtgagctgg
atgtgcacgcggagcgggaacatgctcgggaggcacttcttcacgtcctgggcttcgtgt
ctgcaatatgactttgacactcagtatgctttcgttggtgattattctgggcagatcacc
ctgctgaagcttgaacagaacacgtgttcagtcatcacaaccctcaaaggacatgaaggt
agtgtcgcctgcctctggtgggaccctattcagcggttactcttctcaggagcatctgac
aacagcatcatcatgtgggacatcggaggaaggaaaggccggacgctgttacttcagggc
catcatgacaaggtgcagtcgctgtgctaccttcagctcaccaggcagctcgtctcctgt
tcctcggacggcggaattgcagtgtggaacatggatgttagcagagaagaggctcctcag
tggttggaaagtgattcttgtcagaaatgtgagcagccatttttctggaacataaagcag
atgtgggacaccaagacgctggggctaagacaacatcactgcaggaaatgcgggcaggct
gtctgcgggaagtgcagcagcaagcgctcaagttacccagtcatgggcttcgagttccaa
gtccgggtttgtgattcttgttacgactccatcaaagatgaagatcggacttctctagcg
acctttcatgaaggaaaacataacatttcccacatgtccatggacattgccaggggactg
atggtgacctgtgggaccgaccgcattgtaaagatctgggacatgacacctgtggtgggc
tgcagtctggcgactgggttttctccgcactga

DBGET integrated database retrieval system