KEGG   Homo sapiens (human): 57600Help
Entry
57600             CDS       T01001                                 

Gene name
FNIP2, FNIPL, MAPO1
Definition
(RefSeq) folliculin interacting protein 2
  KO
K20401  folliculin-interacting protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    57600 (FNIP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FNIP_M FNIP_C FNIP_N DUF1645
Motif
Other DBs
NCBI-GeneID: 57600
NCBI-ProteinID: NP_065891
OMIM: 612768
HGNC: 29280
Ensembl: ENSG00000052795
Vega: OTTHUMG00000161983
Pharos: Q9P278(Tbio)
UniProt: Q9P278
Position
4q32.1
AA seq 1114 aa AA seqDB search
MAPTLLQKLFNKRGSSGSSAAASAQGRAPKEGPAFSWSCSEFDLNEIRLIVYQDCDRRGR
QVLFDSKAVQKIEEVTAQKTEDVPIKISAKCCQGSSSVSSSSSSSISSHSSSGGSSHHAK
EQLPKYQYTRPASDVNMLGEMMFGSVAMSYKGSTLKIHYIRSPPQLMISKVFSARMGSFC
GSTNNLQDSFEYINQDPNLGKLNTNQNSLGPCRTGSNLAHSTPVDMPSRGQNEDRDSGIA
RSASLSSLLITPFPSPSSSTSSSSSYQRRWLRSQTTSLENGIIPRRSTDETFSLAEETCS
SNPAMVRRKKIAISIIFSLCEKEEAQRNFQDFFFSHFPLFESHMNRLKSAIEKAMISCRK
IAESSLRVQFYVSRLMEALGEFRGTIWNLYSVPRIAEPVWLTMMSGTLEKNQLCQRFLKE
FTLLIEQINKNQFFAALLTAVLTYHLAWVPTVMPVDHPPIKAFSEKRTSQSVNMLAKTHP
YNPLWAQLGDLYGAIGSPVRLTRTVVVGKQKDLVQRILYVLTYFLRCSELQENQLTWSGN
HGEGDQVLNGSKIITALEKGEVEESEYVVITVRNEPALVPPILPPTAAERHNPWPTGFPE
CPEGTDSRDLGLKPDKEANRRPEQGSEACSAGCLGPASDASWKPQNAFCGDEKNKEAPQD
GSSRLPSCEVLGAGMKMDQQAVCELLKVEMPTRLPDRSVAWPCPDRHLREKPSLEKVTFQ
IGSFASPESDFESRMKKMEERVKACGPSLEASEAADVAQDPQVSRSPFKPGFQENVCCPQ
NRLSEGDEGESDKGFAEDRGSRNDMAADIAGQLSHAADLGTASHGAGGTGGRRLEATRGL
YVKAAEGPVLEPVAPRCVQRGPGLVAGANIPCGDDNKKANFRTEGDIPRNESSDSALGDS
DDEACASAMLDLGHGGDRTGGSLEVELPLPRSQSISTQNVRNFGRSLLAGYCPTYMPDLV
LHGTGSDEKLKQCLVADLVHTVHHPVLDEPIAEAVCIIADTDKWSVQVATSQRKVTDNMK
LGQDVLVSSQVSSLLQSILQLYKLHLPADFCIMHLEDRLQEMYLKSKMLSEYLRGHTRVH
VKELGVVLGIESNDLPLLTAIASTHSPYVAQILL
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atggccccgaccctgctccagaagctcttcaacaaaaggggcagcagcggcagctccgcg
gcggcgtctgcccagggcagggctcctaaggaaggacccgcctttagttggtcatgttcg
gagtttgacctgaatgagattcgcctgatagtttaccaggactgtgacaggagaggcaga
caagtcttgtttgactctaaagctgttcaaaagattgaggaggtgacagctcagaaaaca
gaggatgttcctattaaaatatcagccaagtgctgccagggaagcagcagtgtcagcagc
agtagcagcagcagcatctcttcccacagttcttctgggggatcttcacatcatgctaag
gaacagcttccaaagtaccagtacacaagaccagcttccgatgtcaacatgttaggggaa
atgatgtttggctcagttgccatgagttacaaaggctccaccttaaagatacactacata
cgttctcctccacaactgatgattagtaaagtcttctctgctagaatgggcagcttctgt
ggaagtacaaataacttgcaagacagctttgagtacatcaaccaagatcctaatttggga
aaactgaacacaaatcaaaatagtttgggtccttgtcgtactggaagtaacctagcacac
agcacaccagttgatatgccaagcagaggacagaatgaagacagggacagtggcattgct
cgatcagcctcactaagcagtcttttgatcacacctttcccatctccaagctcctctaca
tcttcttccagcagttaccagcgccgctggcttcgaagtcagacaacaagtttggaaaat
ggcatcatcccaagaaggtcaactgatgagacattcagcttggctgaagaaacctgtagc
tctaatccagctatggttaggaggaagaaaattgccataagcatcatcttttccctatgt
gagaaagaagaagcacaaaggaatttccaggacttcttcttttctcattttcccctgttt
gaatctcacatgaacaggctgaagagtgcaattgaaaaggctatgatctcctgtaggaaa
atagcagaatcaagtctccgagtccagttttatgtcagccgtttgatggaagctctggga
gaattcagaggaactatctggaacttatattctgttccaaggatagctgaacctgtatgg
cttactatgatgtccggcactttggaaaaaaaccagctctgccagcgctttctcaaggag
tttacacttctgatagaacagataaataaaaaccagttttttgctgccttactgactgcg
gtgttaacctaccacctggcctgggtcccaactgtcatgcctgtggatcaccctcccatc
aaagccttctcagagaaacgtacctcccagtcagtgaacatgctggccaaaacacatccg
tataatcctctttgggcacagctgggtgatctttacggagccataggctctccagtgaga
ctgactcgcaccgtagtggtagggaagcagaaggacttagtccagcgaatactttatgtc
ctgacctactttctccgttgctctgagctacaagagaaccagctgacctggagtggcaat
catggtgaaggtgaccaagttttaaatgggagcaagatcataacagccttggagaaagga
gaggtggaggagtctgagtatgtggtcattacggtgaggaacgagcccgctcttgtaccc
cccatcctaccaccaacagcagcagagagacacaacccctggccgacagggtttcctgag
tgcccagagggcactgacagtagagacctgggtcttaaacctgacaaagaagctaacagg
aggccagagcagggttctgaggcttgcagcgcagggtgcctggggccagcatcagacgct
tcctggaaacctcagaatgcattttgtggggatgagaaaaataaagaggcaccgcaagat
ggctcttcaagacttcccagctgtgaagttttgggggcaggaatgaagatggaccagcaa
gctgtctgtgagctgttgaaagtggagatgcctacaagactgccagaccggtcagtggcc
tggccttgccctgacagacatctccgggagaaaccttccttagaaaaggtcactttccag
attggaagctttgcatctccagagtctgactttgaaagccgcatgaaaaaaatggaggaa
cgggtgaaggcctgtggcccctccttggaggccagtgaggctgctgatgtggctcaggac
ccgcaggtttctaggagcccttttaaacctggctttcaggagaatgtttgctgtcctcag
aatcggctttcagagggggatgaaggcgagtctgacaagggttttgcagaggacagaggc
agcagaaacgacatggcagcagatattgctgggcagctcagccacgctgctgacttgggc
acagcctcccacggtgcaggaggaacgggagggaggaggctggaggccactagaggtttg
tatgtgaaggctgcggaaggacctgtgctggagcctgttgcccccaggtgtgtccagcgg
ggccctggcctcgtggctggtgcgaatatcccctgtggggatgacaacaagaaggccaac
ttcaggactgaaggagacattccccgaaatgaaagctcagatagcgccctgggagacagt
gacgacgaagcctgcgcttcagccatgctagatctgggtcacggtggtgacaggactgga
gggtccttggaagtggagctgcctctgccaaggtctcagagcatcagcacccagaatgta
aggaactttggccgctcacttctggcgggctactgccccacatacatgcctgatcttgtg
cttcatgggaccggcagtgatgagaagctgaagcagtgcctggtggccgaccttgtccac
acagtccatcatccagtcctggatgagccaatagctgaagctgtctgtattatcgcagac
acggataaatggagtgtgcaggtagctacaagtcagaggaaagtgacggacaacatgaaa
ctaggccaggatgtcctggtctctagtcaggtgtccagtttgcttcagtccattttacag
ctctataagcttcacctccctgctgatttttgcatcatgcatcttgaagatagactacag
gagatgtaccttaaaagtaaaatgctatctgaatatctccggggacacacacgagtccat
gtgaaagaattaggtgtcgtactggggattgaatccaacgacctgcctctgttgactgct
attgccagtactcattctccttatgtggctcaaatactcttataa

KEGG   Homo sapiens (human): 96459Help
Entry
96459             CDS       T01001                                 

Gene name
FNIP1
Definition
(RefSeq) folliculin interacting protein 1
  KO
K20400  folliculin-interacting protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    96459 (FNIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FNIP_M FNIP_C FNIP_N DUF1810
Motif
Other DBs
NCBI-GeneID: 96459
NCBI-ProteinID: NP_588613
OMIM: 610594
HGNC: 29418
Ensembl: ENSG00000217128
Vega: OTTHUMG00000186338
Pharos: Q8TF40(Tdark)
UniProt: Q8TF40
Position
5q31.1
AA seq 1166 aa AA seqDB search
MAPTLFQKLFSKRTGLGAPGRDARDPDCGFSWPLPEFDPSQIRLIVYQDCERRGRNVLFD
SSVKRRNEDISVSKLGSDAQVKVFGKCCQLKPGGDSSSSLDSSVTSSSDIKDQCLKYQGS
RCSSDANMLGEMMFGSVAMSYKGSTLKIHQIRSPPQLMLSKVFTARTGSSICGSLNTLQD
SLEFINQDNNTLKADNNTVINGLLGNIGLSQFCSPRRAFSEQGPLRLIRSASFFAVHSNP
MDMPGRELNEDRDSGIARSASLSSLLITPFPSPNSSLTRSCASSYQRRWRRSQTTSLENG
VFPRWSIEESFNLSDESCGPNPGIVRKKKIAIGVIFSLSKDEDENNKFNEFFFSHFPLFE
SHMNKLKSAIEQAMKMSRRSADASQRSLAYNRIVDALNEFRTTICNLYTMPRIGEPVWLT
MMSGTPEKNHLCYRFMKEFTFLMENASKNQFLPALITAVLTNHLAWVPTVMPNGQPPIKI
FLEKHSSQSVDMLAKTHPYNPLWAQLGDLYGAIGSPVRLARTVVVGKRQDMVQRLLYFLT
YFIRCSELQETHLLENGEDEAIVMPGTVITTTLEKGEIEESEYVLVTMHRNKSSLLFKES
EEIRTPNCNCKYCSHPLLGQNVENISQQEREDIQNSSKELLGISDECQMISPSDCQEENA
VDVKQYRDKLRTCFDAKLETVVCTGSVPVDKCALSESGLESTEETWQSEKLLDSDSHTGK
AMRSTGMVVEKKPPDKIVPASFSCEAAQTKVTFLIGDSMSPDSDTELRSQAVVDQITRHH
TKPLKEERGAIDQHQETKQTTKDQSGESDTQNMVSEEPCELPCWNHSDPESMSLFDEYFN
DDSIETRTIDDVPFKTSTDSKDHCCMLEFSKILCTKNNKQNNEFCKCIETVPQDSCKTCF
PQQDQRDTLSILVPHGDKESSDKKIAVGTEWDIPRNESSDSALGDSESEDTGHDMTRQVS
SYYGGEQEDWAEEDEIPFPGSKLIEVSAVQPNIANFGRSLLGGYCSSYVPDFVLQGIGSD
ERFRQCLMSDLSHAVQHPVLDEPIAEAVCIIADMDKWTVQVASSQRRVTDNKLGKEVLVS
SLVSNLLHSTLQLYKHNLSPNFCVMHLEDRLQELYFKSKMLSEYLRGQMRVHVKELGVVL
GIESSDLPLLAAVASTHSPYVAQILL
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atggcccctacgctgttccagaagctcttcagcaagaggaccgggctgggcgcgcccggc
cgcgacgcccgggacccagattgcgggttcagttggcctttaccagagtttgatccaagc
cagattcgactgattgtatatcaagactgtgaaagacgagggagaaatgttttgtttgac
tccagtgttaagagaagaaatgaggacatatcagtatcgaaactcggcagtgatgctcaa
gttaaagtctttgggaaatgctgccaactgaaacctggaggagacagttcttcctcttta
gatagttctgtgacttcatcttctgatataaaagaccagtgtcttaagtaccagggttct
cggtgctcttctgatgccaatatgcttggagagatgatgtttggctcagtagcaatgagc
tacaaaggatccaccttaaaaattcatcagattcgttcccctccacagctcatgctcagc
aaagtgtttactgctcggactggcagcagtatttgtgggagtctcaatacgctacaagat
agtcttgaattcatcaatcaggacaacaatacattaaaggctgataataacacagttatt
aatggactgcttggaaatataggtctttcacagttctgcagccccaggcgggcattctct
gagcagggtccgctccgcctgatcaggagcgcctctttctttgcagttcacagcaaccca
atggacatgcctggaagagagctcaatgaggacagagacagtggcatagcacggtctgca
tctctcagcagcttgctgatcactccatttccttccccaaactcctcacttacccgaagt
tgtgccagcagctaccagcgacgttggcgacgcagccaaacaacaagtttggaaaatggg
gtatttcctagatggtctatagaagaaagctttaatctctcagatgaaagctgtggccct
aacccaggaattgtgcggaaaaagaagattgcaattggggtaatcttttcattgtccaaa
gatgaagatgaaaataacaaatttaatgaattctttttttcacattttcctctctttgaa
agccacatgaacaaattaaagagtgcaatagaacaggctatgaaaatgagccggagatca
gctgatgccagtcagagaagtttggcatataatcgaatagttgatgccctaaatgaattc
agaacaacaatttgtaatctttacacgatgccacgaattggagaacctgtctggcttaca
atgatgtcggggactccagaaaagaaccacctttgctatcgtttcatgaaggagttcacc
tttctaatggaaaatgcttccaaaaatcaattcttgccagctctcattactgcagttctg
accaatcatcttgcctgggttccaacagtcatgccaaatggacaaccacctataaaaata
tttttagaaaagcattcctctcagagtgtggacatgttggcaaagactcatccatataac
ccactttgggcacaactgggagacttgtatggcgctattggctctcccgtacggttagca
aggactgtggtagttggcaaacgacaagacatggtccagaggctactttattttcttact
tattttataagatgctctgaacttcaagaaacgcatcttttagaaaatggagaagatgaa
gccatcgttatgccaggcacagtaattactaccactttagagaaaggtgaaatagaagaa
tcagagtatgtccttgtcacaatgcatagaaacaaaagcagtttgctctttaaagagtca
gaagaaattagaactcccaattgtaactgtaaatattgcagtcatccactccttgggcaa
aatgtagagaacatttcacaacaagagagagaagatattcaaaacagctctaaggagctg
ctaggaatttcagatgagtgccagatgatttctccttctgactgccaagaagaaaatgct
gttgatgttaaacagtacagagataaattaagaacttgctttgacgccaagttagagaca
gttgtttgcacaggatctgttccagtagacaaatgtgcattgtcagagtcaggcttagag
tcaacagaggaaacatggcagagtgagaagttgctggattcagacagtcacacaggcaaa
gcaatgagatccacaggaatggttgtggaaaaaaaacctccagataagattgtgcctgct
tcattttcttgtgaggctgcccagacaaaggttactttcctgattggggattctatgtca
cctgattcagatactgagcttcgaagtcaggcagtggtggatcagattaccagacatcac
accaaaccattgaaggaagaaagaggggctattgatcagcatcaagaaactaaacaaaca
accaaggaccaatctggagagtctgatacacagaacatggtttctgaagagccctgtgaa
cttccctgttggaatcattcagacccagaaagcatgagcttattcgacgaatattttaat
gatgattcaatcgaaaccaggactattgatgatgttccatttaaaacaagtacagatagt
aaagaccattgctgtatgttagagttttcaaaaatattgtgtacaaaaaataacaagcag
aacaatgaattttgtaaatgtatagaaacagttccccaagattcatgtaaaacctgcttt
cctcagcaggaccaaagagatacactctccattcttgtcccccatggggataaagagagt
tcagataaaaaaattgctgtaggaactgaatgggacattccaagaaatgaaagttcagac
agtgcccttggggatagtgaaagtgaagatacaggtcatgatatgactagacaagttagc
agttattatggaggagagcaagaagattgggcagaagaggatgagataccttttcctggg
tcaaagttaatcgaagtgagtgctgttcagcccaacattgccaacttcgggaggtccttg
ctgggtggctactgctcatcttatgtgcctgactttgttcttcaaggaattgggagtgat
gagaggttccgtcagtgtctgatgtcagatttatctcatgctgtgcagcatccagttttg
gatgaaccaatagcagaagctgtctgtattatagctgacatggataaatggactgttcaa
gtggccagtagccagagacgagtgacagataataaattgggaaaggaagtattggtttcc
agtcttgtttccaatctgcttcattccacacttcagctttataagcataacttgtctcca
aatttttgtgtaatgcatcttgaagaccggttgcaggagctatacttcaaaagtaaaatg
ctgtctgaatacctgagggggcagatgcgtgttcatgtcaaggagctgggagtggttctg
gggattgaatccagtgatcttccacttctggctgctgtagcaagcactcactctccatat
gttgcacaaatactcctttaa

DBGET integrated database retrieval system