KEGG   Homo sapiens (human): 57610Help
Entry
57610             CDS       T01001                                 

Gene name
RANBP10
Definition
(RefSeq) RAN binding protein 10
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: CLTH SPRY LisH SPX SOG2 PRCC
Motif
Other DBs
NCBI-GeneID: 57610
NCBI-ProteinID: NP_065901
OMIM: 614031
HGNC: 29285
Ensembl: ENSG00000141084
Vega: OTTHUMG00000184044
Pharos: Q6VN20(Tdark)
UniProt: Q6VN20
Position
16q22.1
AA seq 620 aa AA seqDB search
MAAATADPGAGNPQPGDSSGGGAGGGLPSPGEQELSRRLQRLYPAVNQQETPLPRSWSPK
DKYNYIGLSQGNLRVHYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGI
GLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINGTC
FYTKNGHSLGIAFTDLPANLYPTVGLQTPGEIVDANFGQQPFLFDIEDYMREWRAKVQGT
VHCFPISARLGEWQAVLQNMVSSYLVHHGYCATATAFARMTETPIQEEQASIKNRQKIQK
LVLEGRVGEAIETTQRFYPGLLEHNPNLLFMLKCRQFVEMVNGTDSEVRSLSSRSPKSQD
SYPGSPSLSPRHGPSSSHMHNTGADSPSCSNGVASTKSKQNHSKYPAPSSSSSSSSSSSS
SSPSSVNYSESNSTDSTKSQHHSSTSNQETSDSEMEMEAEHYPNGVLGSMSTRIVNGAYK
HEDLQTDESSMDDRHPRRQLCGGNQAATERIILFGRELQALSEQLGREYGKNLAHTEMLQ
DAFSLLAYSDPWSCPVGQQLDPIQREPVCAALNSAILESQNLPKQPPLMLALGQASECLR
LMARAGLGSCSFARVDDYLH
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcgacggcagacccgggagctgggaacccgcagcctggggactcctccggc
gggggcgctgggggcgggctgccgtcccctggggagcaggagctgagccggcgcttgcag
cgcctgtatcccgcggtcaaccagcaagagactccgctgccgcgctcctggagccccaag
gacaaatacaactacattggtctctcccagggcaacctccgcgtccactacaaaggtcat
ggcaaaaatcacaaagatgcggcctcagtgcgtgccacccaccccatacctgctgcctgt
ggcatttattactttgaagtgaagattgtcagcaaaggaagagatggttacatgggaata
ggactctcggctcaaggcgtcaacatgaacagacttcctggttgggacaaacattcctat
ggttaccatggtgatgatgggcattcgttctgctcctcggggactggccagccctatggt
cccacattcaccacaggagacgtgatcggctgctgtgtcaacctcatcaatggcacctgc
ttctacaccaagaatggccacagccttggtatagccttcacagacctcccggccaacctc
taccccaccgtaggcctgcagacacctggggagattgtggacgccaactttgggcagcag
cccttcctgtttgacattgaggactacatgcgggagtggcgtgccaaggtccagggcacg
gtccactgcttccccatcagtgcccggcttggcgagtggcaggcagtgctgcagaacatg
gtttcatcttacctcgtgcatcatgggtattgtgccacagccacggcttttgctcgaatg
actgaaaccccgattcaggaagaacaggcgtccataaagaacagacaaaagatccagaag
ctggtgctggagggccgtgtgggcgaggccatcgagaccacccagcgcttctacccaggg
ctgctggagcacaaccccaacctcctcttcatgctcaagtgccggcagtttgtggagatg
gtgaatgggacggacagtgaggtccgaagtttgagctcccgaagccccaagtcccaggac
agctaccctggctcccccagcctcagtccccgacatggccccagtagttcccacatgcac
aacacaggagcagacagtcccagctgtagcaatggcgtcgcgtccaccaagagcaaacag
aaccacagtaaataccctgcacccagctcctcatcctcgtcctcctcctcctcctcgtcc
tcttccccatcctccgtcaattactccgagtccaactcaacagactccaccaagtcccag
caccacagcagtaccagtaaccaggagaccagcgacagtgagatggagatggaggcagag
cactaccccaacggtgtgctaggaagcatgtccacacgcattgttaatggtgcctacaag
catgaggacctgcagacggatgagtccagcatggatgacaggcatcctcggcggcagctc
tgcgggggcaaccaggctgccacagaaaggatcattctgtttggccgcgagttgcaggca
ttgagtgagcagttgggccgggagtacggcaagaatttggcccacacagagatgctgcag
gatgccttcagcctgctggcatactcagacccctggagctgcccagttggccagcagctt
gaccccatccagagggaacctgtgtgtgctgccctcaacagcgccattttagagtcccag
aacctgccaaagcagccccctctgatgctcgccctgggccaggcatctgagtgtctccgg
ctcatggcccgagcaggcctgggttcttgctcctttgccagagttgatgactacttgcac
tag

DBGET integrated database retrieval system