KEGG   Homo sapiens (human): 57623Help
Entry
57623             CDS       T01001                                 

Gene name
ZFAT, AITD3, ZFAT1, ZNF406
Definition
(RefSeq) zinc finger and AT-hook domain containing
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-H2C2_5 zf-Di19 zf-met zf-C4_ClpX Rad50_zn_hook
Motif
Other DBs
NCBI-GeneID: 57623
NCBI-ProteinID: NP_065914
OMIM: 610931
HGNC: 19899
Ensembl: ENSG00000066827
Vega: OTTHUMG00000164321
Pharos: Q9P243(Tbio)
UniProt: Q9P243
Structure
PDB: 

Position
8q24.22
AA seq 1243 aa AA seqDB search
METRAAENTAIFMCKCCNLFSPNQSELLSHVSEKHMEEGVNVDEIIIPLRPLSTPEPPNS
SKTGDEFLVMKRKRGRPKGSTKKSSTEEELAENIVSPTEDSPLAPEEGNSLPPSSLECSK
CCRKFSNTRQLRKHICIIVLNLGEEEGEAGNESDLELEKKCKEDDREKASKRPRSQKTEK
VQKISGKEARQLSGAKKPIISVVLTAHEAIPGATKIVPVEAGPPETGATNSETTSADLVP
RRGYQEYAIQQTPYEQPMKSSRLGPTQLKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYK
CPQCSYASAIKANLNVHLRKHTGEKFACDYCSFTCLSKGHLKVHIERVHKKIKQHCRFCK
KKYSDVKNLIKHIRDAHDPQDKKVKEALDELCLMTREGKRQLLYDCHICERKFKNELDRD
RHMLVHGDKWPFACELCGHGATKYQALELHVRKHPFVYVCAVCRKKFVSSIRLRTHIKEV
HGAAQEALVFTSSINQSFCLLEPGGDIQQEALGDQLQLVEEEFALQGVNALKEEACPGDT
QLEEGRKEPEAPGEMPAPAVHLASPQAESTALPPCELETTVVSSSDLHSQEVVSDDFLLK
NDTSSAEAHAAPEKPPDMQHRSSVQTQGEVITLLLSKAQSAGSDQESHGAQSPLGEGQNM
AVLSAGDPDPSRCLRSNPAEASDLLPPVAGGGDTITHQPDSCKAAPEHRSGITAFMKVLN
SLQKKQMNTSLCERIRKVYGDLECEYCGKLFWYQVHFDMHVRTHTREHLYYCSQCHYSSI
TKNCLKRHVIQKHSNILLKCPTDGCDYSTPDKYKLQAHLKVHTALDKRSYSCPVCEKSFS
EDRLIKSHIKTNHPEVSMSTISEVLGRRVQLKGLIGKRAMKCPYCDFYFMKNGSDLQRHI
WAHEGVKPFKCSLCEYATRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHT
ADGKQFKCTVCDYTAAQKPQLLRHMEQHVSFKPFRCAHCHYSCNISGSLKRHYNRKHPNE
EYANVGTGELAAEVLIQQGGLKCPVCSFVYGTKWEFNRHLKNKHGLKVVEIDGDPKWETA
TEAPEEPSTQYLHITEAEEDVQGTQAAVAALQDLRYTSESGDRLDPTAVNILQQIIELGA
ETHDATALASVVAMAPGTVTVVKQVTEEEPSSNHTVMIQETVQQASVELAEQHHLVVSSD
DVEGIETVTVYTQGGEASEFIVYVQEAMQPVEEQAVEQPAQEL
NT seq 3732 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcgggcggcagaaaacacggccatctttatgtgtaaatgttgtaacctcttc
tcaccaaatcagtcggaactcctctcccacgtttcagagaagcacatggaagaaggggtt
aatgttgatgagattattattccccttaggcctctgagtacacctgaaccccccaactca
agcaaaaccggagatgagtttttggtcatgaagaggaagagaggcaggcctaaggggtcc
acgaagaagtccagcacagaagaggagctggcagaaaacatcgtgagtccgactgaggac
agcccgctggctccggaggaagggaacagcctgcctccaagcagcttggagtgtagcaag
tgctgtcggaagttctccaacacgcgccagctgcggaagcacatctgcattatcgtgctg
aatttgggtgaggaggaaggagaagcaggtaacgagtctgaccttgaactagaaaagaag
tgtaaggaagatgatcgggaaaaagcctcgaaaagaccacggtcacagaaaacagagaaa
gtccagaagatctcaggaaaggaggccagacagctttctggggcgaagaaacccatcata
agtgtggttttaactgcacacgaagcaattccaggtgctaccaagattgtgccagtggag
gctgggccccctgaaacaggagctacaaattctgagaccacttcagcagacctggtgcct
cggagaggctaccaggaatacgccattcagcagacaccttatgagcaaccaatgaagtca
agcaggctaggtcccactcagctcaaaatcttcacttgtgaatactgcaacaaggtcttc
aagttcaagcactcgctgcaggcccacctgaggatccacaccaatgaaaagccatacaag
tgcccccagtgcagctatgccagtgccatcaaggccaacctcaatgtgcacctgcgcaag
cacactggagagaagttcgcctgcgactattgctcgttcacctgcctgagcaagggccac
ctcaaggtgcacatcgagcgagtgcacaagaagatcaagcagcactgccgcttctgcaag
aagaagtactctgacgtcaagaacctcatcaagcacatccgagacgcgcatgacccacag
gacaagaaggtcaaagaggccttggacgagctctgcctgatgacgagggagggcaagcgg
cagctgctctatgactgccacatctgtgagcgcaagttcaagaacgagctggaccgtgac
cgccatatgctggtccacggagacaagtggccttttgcctgtgagctctgtggccatggg
gccaccaagtaccaggcgctggaactgcatgtcaggaagcaccccttcgtgtacgtctgt
gccgtctgccgcaagaagttcgtcagctccatcaggctgcgcacccacatcaaagaggtg
cacggggctgcccaggaggccttggtcttcaccagttccatcaaccagagcttctgcctc
ctggaacctggtggggacatccagcaagaagctctgggggaccagctacagctggtggaa
gaggagtttgccctccagggcgtgaatgcactcaaggaagaggcctgtcctggggacact
cagctggaggagggccggaaggagccggaggcccctggggaaatgcctgccccagctgtg
cacctggcctccccgcaggccgaaagcacagccctgccaccctgtgagctggaaaccacc
gtggtctcctcctcagacctgcattctcaagaggtggtttcagatgattttttgttgaaa
aatgatacctcctccgcagaggctcatgctgctcctgagaagcccccagacatgcagcac
agaagctcagtccagacgcaaggtgaagtgatcacactactgctgtccaaggcccagagt
gctgggtcagatcaggaaagccatggcgcccagagccccctaggggaagggcagaacatg
gctgtgctttcagctggtgacccagatcccagcaggtgtctcaggtcaaacccagctgag
gcctcagacctcctccctccagtagctggtggtggggacaccatcacacatcagcctgac
tcttgcaaagctgcccctgagcaccggtcaggcatcaccgctttcatgaaggtcctgaac
agtttacagaagaagcaaatgaacaccagcttgtgtgagcggatccggaaggtttatgga
gacctggagtgtgaatactgtggcaaacttttttggtaccaagtgcattttgatatgcat
gtccgcacccacacccgggaacatctgtattattgctctcagtgtcattattcttccatc
accaaaaactgccttaaacgccacgtaattcagaaacacagtaacatcttgctgaagtgt
cccaccgatggctgtgactactcaactccagataaatataagctacaggcacatcttaaa
gttcacacagcactggacaaaaggagttattcttgtcctgtttgtgaaaagtctttttca
gaggatcgattgataaagtcacatatcaagaccaaccatcctgaggtctccatgagcacc
atttctgaggttctcgggaggagggttcagctgaaagggctaattggaaagagagccatg
aaatgcccatattgtgacttttatttcatgaagaatggctcagaccttcagcgtcatatt
tgggctcatgaaggtgtgaagcccttcaagtgttctttgtgtgagtatgcaactcgtagc
aagagtaacctcaaggctcatatgaatcgtcacagcactgagaaaacccacctatgtgac
atgtgtggcaagaaattcaaatcaaaagggacactgaaaagtcacaaactccttcacact
gcagatgggaagcagtttaagtgcacggtgtgtgactacacagcggcccagaagccacag
ctgctgcggcacatggaacagcatgtctccttcaagcctttccgctgtgcccattgccat
tactcctgcaacatatctggctctctgaagcggcactacaacaggaagcaccctaatgag
gagtatgccaacgtgggcaccggggagctggcagcggaggtgctcatccagcaaggtggt
ttgaagtgtcctgtttgcagctttgtatatggcaccaaatgggagttcaataggcacttg
aagaacaaacatggcttgaaggtggtggaaattgatggagaccccaagtgggagacagca
acagaagctcctgaggagccctccacccagtatctccacatcacagaggccgaagaagac
gttcaagggacacaggcagcggtggccgcgctccaggacctgagatacacctctgagagt
ggcgaccgactggaccccacggccgtgaacatcctgcagcagatcattgagctgggcgcc
gagacccatgacgccactgcccttgcctcggtggttgccatggcaccagggacggtgact
gtggttaagcaggtcaccgaggaggagcccagctccaaccacacggtcatgatccaggag
acggtccagcaagcgtccgtggagcttgccgagcagcaccacctggtggtgtcctccgac
gacgtggagggcattgagacggtgactgtctacacgcagggcggggaggcctcggagttc
atcgtctacgtgcaggaggccatgcagcctgtggaggagcaggctgtggagcagccggcc
caggaactctag

DBGET integrated database retrieval system