KEGG   Homo sapiens (human): 57630Help
Entry
57630             CDS       T01001                                 

Gene name
SH3RF1, POSH, RNF142, SH3MD2
Definition
(RefSeq) SH3 domain containing ring finger 1
  KO
K12171  E3 ubiquitin-protein ligase SH3RF [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    57630 (SH3RF1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    57630 (SH3RF1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     57630 (SH3RF1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     57630 (SH3RF1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    57630 (SH3RF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_9 SH3_1 SH3_2 zf-C3HC4 zf-RING_UBOX zf-C3HC4_2 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-C3HC4_4 Prok-RING_4 zf-RING_4 zf-RING_11 zf-Nse zf-MIZ
Motif
Other DBs
NCBI-GeneID: 57630
NCBI-ProteinID: NP_065921
HGNC: 17650
Ensembl: ENSG00000154447
Vega: OTTHUMG00000161010
Pharos: Q7Z6J0(Tbio)
UniProt: Q7Z6J0
Position
4q32.3-q33
AA seq 888 aa AA seqDB search
MDESALLDLLECPVCLERLDASAKVLPCQHTFCKRCLLGIVGSRNELRCPECRTLVGSGV
EELPSNILLVRLLDGIKQRPWKPGPGGGSGTNCTNALRSQSSTVANCSSKDLQSSQGGQQ
PRVQSWSPPVRGIPQLPCAKALYNYEGKEPGDLKFSKGDIIILRRQVDENWYHGEVNGIH
GFFPTNFVQIIKPLPQPPPQCKALYDFEVKDKEADKDCLPFAKDDVLTVIRRVDENWAEG
MLADKIGIFPISYVEFNSAAKQLIEWDKPPVPGVDAGECSSAAAQSSTAPKHSDTKKNTK
KRHSFTSLTMANKSSQASQNRHSMEISPPVLISSSNPTAAARISELSGLSCSAPSQVHIS
TTGLIVTPPPSSPVTTGPSFTFPSDVPYQAALGTLNPPLPPPPLLAATVLASTPPGATAA
AAAAGMGPRPMAGSTDQIAHLRPQTRPSVYVAIYPYTPRKEDELELRKGEMFLVFERCQD
GWFKGTSMHTSKIGVFPGNYVAPVTRAVTNASQAKVPMSTAGQTSRGVTMVSPSTAGGPA
QKLQGNGVAGSPSVVPAAVVSAAHIQTSPQAKVLLHMTGQMTVNQARNAVRTVAAHNQER
PTAAVTPIQVQNAAGLSPASVGLSHHSLASPQPAPLMPGSATHTAAISISRASAPLACAA
AAPLTSPSITSASLEAEPSGRIVTVLPGLPTSPDSASSACGNSSATKPDKDSKKEKKGLL
KLLSGASTKRKPRVSPPASPTLEVELGSAELPLQGAVGPELPPGGGHGRAGSCPVDGDGP
VTTAVAGAALAQDAFHRKASSLDSAVPIAPPPRQACSSLGPVLNESRPVVCERHRVVVSY
PPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atggatgaatcagccttgttggatcttttggagtgtccggtgtgtctagagcgccttgat
gcttctgcgaaggtcttgccttgccagcatacgttttgcaagcgatgtttgctggggatc
gtaggttctcgaaatgaactcagatgtcccgagtgcaggactcttgttggctcgggtgtc
gaggagcttcccagtaacatcttgctggtcagacttctggatggcatcaaacagaggcct
tggaaacctggtcctggtgggggaagtgggaccaactgcacaaatgcattaaggtctcag
agcagcactgtggctaattgtagctcaaaagatctgcagagctcccagggcggacagcag
cctcgggtgcaatcctggagccccccagtgaggggtatacctcagttaccatgtgccaaa
gcattatacaactatgaaggaaaagagcctggagaccttaaattcagcaaaggtgacatc
atcattttgcgaagacaagtggatgaaaattggtaccatggggaagtcaatggaatccat
ggctttttccccaccaactttgtgcagattattaaaccgttacctcagcccccacctcag
tgcaaagcactttatgactttgaagtgaaagacaaggaagcagacaaagattgccttcca
tttgcaaaggatgatgttctgactgtgatccgaagagtggatgaaaactgggctgaagga
atgctggcagacaaaataggaatatttccaatttcatatgttgagtttaactcggctgct
aagcagctgatagaatgggataagcctcctgtgccaggagttgatgctggagaatgttcc
tcggcagcagcccagagcagcactgccccaaagcactccgacaccaagaagaacaccaaa
aagcggcactccttcacttccctcactatggccaacaagtcctcccaggcatcccagaac
cgccactccatggagatcagcccccctgtcctcatcagctccagcaaccccactgctgct
gcacggatcagcgagctgtctgggctctcctgcagtgccccttctcaggttcatataagt
accaccgggttaattgtgaccccgcccccaagcagcccagtgacaactggcccctcgttt
actttcccatcagatgttccctaccaagctgcccttggaactttgaatcctcctcttcca
ccaccccctctcctggctgccactgtccttgcctccacaccaccaggcgccaccgccgct
gctgctgctgctggaatgggaccgaggcccatggcaggatccactgaccagattgcacat
ttacggccgcagactcgccccagtgtgtatgttgctatatatccatacactcctcggaaa
gaggatgaactagagctgagaaaaggggagatgtttttagtgtttgagcgctgccaggat
ggctggttcaaagggacatccatgcataccagcaagataggggttttccctggcaattat
gtggcaccagtcacaagggcggtgacaaatgcttcccaagctaaagtccctatgtctaca
gctggccagacaagtcggggagtgaccatggtcagtccttccacggcaggagggcctgcc
cagaagctccagggaaatggcgtggctgggagtcccagtgttgtccccgcagctgtggta
tcagcagctcacatccagacaagtcctcaggctaaggtcttgttgcacatgacggggcaa
atgacagtcaaccaggcccgcaatgctgtgaggacagttgcagcgcacaaccaggaacgc
cccacggcagcagtgacacccatccaggtacagaatgccgccggcctcagccctgcatct
gtgggcctgtcccatcactcgctggcctccccacaacctgcgcctctgatgccaggctca
gccacgcacactgctgccatcagtatcagtcgagccagtgcccctctggcctgtgcagca
gctgctccactgacttccccaagcatcaccagtgcttctctggaggctgagcccagtggc
cggatagtgaccgttctccctggactccccacatctcctgacagtgcttcatcagcttgt
gggaacagttcagcaaccaaaccagacaaggatagcaaaaaagaaaaaaagggtttgttg
aagttgctttctggcgcctccactaaacggaagccccgcgtgtctcctccagcatcgccc
accctagaagtggagctgggcagtgcagagcttcctctccagggagcggtggggcccgaa
ctgccaccaggaggtggccatggcagggcaggctcctgccctgtggacggggacggaccg
gtcacgactgcagtggcaggagcagccctggcccaggatgcttttcataggaaggcaagt
tccctggactccgcagttcccatcgctccacctcctcgccaggcctgttcctccctgggt
cctgtcttgaatgagtctagacctgtcgtttgtgaaaggcacagggtggtggtttcctat
cctcctcagagtgaggcagaacttgaacttaaagaaggagatattgtgtttgttcataaa
aaacgagaggatggctggttcaaaggcacattacaacgtaatgggaaaactggccttttc
ccaggaagctttgtggaaaacatatga

DBGET integrated database retrieval system