KEGG   Homo sapiens (human): 5764
Entry
5764              CDS       T01001                                 

Gene name
PTN, HARP, HB-GAM, HBBM, HBGF-8, HBGF8, HBNF, HBNF-1, NEGF1, OSF-1
Definition
(RefSeq) pleiotrophin
  KO
K16642  pleiotrophin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    5764 (PTN)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   5764 (PTN)
SSDB
Motif
Pfam: PTN_MK_N PTN_MK_C
Other DBs
NCBI-GeneID: 5764
NCBI-ProteinID: NP_001308315
OMIM: 162095
HGNC: 9630
Ensembl: ENSG00000105894
Vega: OTTHUMG00000155709
Pharos: P21246(Tbio)
UniProt: P21246 A0A024R778
Structure
PDB: 
2N6F

Position
7q33
AA seq 168 aa
MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSG
DCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTG
SLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
NT seq 507 nt   +upstreamnt  +downstreamnt
atgcaggctcaacagtaccagcagcagcgtcgaaaatttgcagctgccttcttggcattc
attttcatactggcagctgtggatactgctgaagcagggaagaaagagaaaccagaaaaa
aaagtgaagaagtctgactgtggagaatggcagtggagtgtgtgtgtgcccaccagtgga
gactgtgggctgggcacacgggagggcactcggactggagctgagtgcaagcaaaccatg
aagacccagagatgtaagatcccctgcaactggaagaagcaatttggcgcggagtgcaaa
taccagttccaggcctggggagaatgtgacctgaacacagccctgaagaccagaactgga
agtctgaagcgagccctgcacaatgccgaatgccagaagactgtcaccatctccaagccc
tgtggcaaactgaccaagcccaaacctcaagcagaatctaagaagaagaaaaaggaaggc
aagaaacaggagaagatgctggattaa

DBGET integrated database retrieval system