KEGG   Homo sapiens (human): 57642Help
Entry
57642             CDS       T01001                                 

Gene name
COL20A1, bA261N11.4
Definition
(RefSeq) collagen type XX alpha 1 chain
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 VWA Collagen VWA_2 Pur_ac_phosph_N DUF4959
Motif
Other DBs
NCBI-GeneID: 57642
NCBI-ProteinID: NP_065933
HGNC: 14670
Ensembl: ENSG00000101203
Vega: OTTHUMG00000032964
Pharos: Q9P218(Tdark)
UniProt: Q9P218
Structure
PDB: 

Position
20q13.33
AA seq 1284 aa AA seqDB search
MSSGDPAHLGLCLWLWLGATLGREQVQASGLLRLAVLPEDRLQMKWRESEGSGLGYLVQV
KPMAGDSEQEVILTTKTPKATVGGLSPSKGYTLQIFELTGSGRFLLARREFVIEDLKSSS
LDRSSQRPLGSGAPEPTPSHTGSPDPEQASEPQVAFTPSQDPRTPAGPQFRCLPPVPADM
VFLVDGSWSIGHSHFQQVKDFLASVIAPFEIGPDKVQVGLTQYSGDAQTEWDLNSLSTKE
QVLAAVRRLRYKGGNTFTGLALTHVLGQNLQPAAGLRPEAAKVVILVTDGKSQDDVHTAA
RVLKDLGVNVFAVGVKNADEAELRLLASPPRDITVHSVLDFLQLGALAGLLSRLICQRLQ
GGSPRQGPAAAPALDTLPAPTSLVLSQVTSSSIRLSWTPAPRHPLKYLIVWRASRGGTPR
EVVVEGPAASTELHNLASRTEYLVSVFPIYEGGVGEGLRGLVTTAPLPPPRALTLAAVTP
RTVHLTWQPSAGATHYLVRCSPASPKGEEEEREVQVGRPEVLLDGLEPGRDYEVSVQSLR
GPEGSEARGIRARTPTLAPPRHLGFSDVSHDAARVFWEGAPRPVRLVRVTYVSSEGGHSG
QTEAPGNATSATLGPLSSSTTYTVRVTCLYPGGGSSTLTGRVTTKKAPSPSQLSMTELPG
DAVQLAWVAAAPSGVLVYQITWTPLGEGKAHEISVPGNLGTAVLPGLGRHTEYDVTILAY
YRDGARSDPVSLRYTPSTVSRSPPSNLALASETPDSLQVSWTPPLGRVLHYWLTYAPASG
LGPEKSVSVPGARSHVTLPDLQAATKYRVLVSAIYAAGRSEAVSATGQTACPALRPDGSL
PGFDLMVAFSLVEKAYASIRGVAMEPSAFGGTPTFTLFKDAQLTRRVSDVYPAPLPPEHT
IVFLVRLLPETPREAFALWQMTAEDFQPLLGVLLDAGKKSLTYFHRDPRAALQEATFDPQ
EVRKIFFGSFHKVHVAVGRSKVRLYVDCRKVAERPLGEMGSPPAAGFVTLGRLAKARGPR
SSSAAFQLQMLQIVCSDTWADEDRCCELPASRDGETCPAFVSACSCSSETPGPPGPQGPP
GLPGRNGTPGEQGFPGPRGPPGVKGEKGDHGLPGLQGHPGHQGIPGRVGLQGPKGMRGLE
GTAGLPGPPGPRGFQGMAGARGTSGERGPPGTVGPTGLPGPKGERGEKGEPQSLATLYQL
VSQASHVSKFDSFHENTRPPMPILEQKLEPGTEPLGSPGTRSKALVPGEWGRGGRHLEGR
GEPGAVGQMGSPGQQGASTQGLWE
NT seq 3855 nt NT seq  +upstreamnt  +downstreamnt
atgagctccggagaccctgcacacctcggcctctgcctctggctgtggctgggcgccacc
ctgggaagagagcaagttcaagcaagcggtctcctgaggctggctgtgctgcctgaggac
cggctgcagatgaagtggagagagtcggaggggagcggcctcggctacctggtgcaggtg
aagcccatggcaggggactcggaacaggaggtgatactgaccaccaagacccctaaggcc
acagtggggggcctgagcccctccaagggctacaccttgcagatcttcgagctcactggc
tctgggcgcttcctgctagctcggagggagtttgtgattgaggatctgaagagtagctcc
ctggacaggagcagccagaggcccctcggctctggagccccggagcccaccccctcccac
acggggagcccagaccctgagcaggcttctgagccccaagttgccttcacaccaagccag
gatccgcgcactcctgccggcccccagttccgctgcctgccccccgtgcctgctgacatg
gtcttcctggtggacgggtcctggagcattggccacagtcacttccagcaggtcaaggac
ttcctggccagtgtcatcgcaccctttgaaatcgggccggataaggtccaagtaggcctg
actcagtacagcggggatgctcagactgagtgggacctgaactccctcagcaccaaggaa
caggtgctggcagctgtgcgccgcctccgctacaagggggggaacacgttcacaggcctt
gccctgacccacgtgctggggcagaacctgcagccggcggctggcctccgtccagaggca
gccaaggtggtgattctggtgacggacggcaagtcccaggacgatgtgcacactgctgcc
cgtgtcctcaaggacctgggcgtgaacgtcttcgctgtgggtgtgaagaacgccgatgag
gctgagctgaggctcctggcgtccccgccgagggacatcaccgtccacagcgtgctggac
ttcctgcagctcggcgcgctggctggcctgctcagccgtctcatctgccagaggctccag
ggtgggagcccgcggcagggcccagcagcggctccagccctggacaccctccctgccccc
accagcctggtcctgagccaggtgacctcctccagcatccgcctgtcctggactccagcc
ccccggcaccccctcaagtatctgatcgtttggcgagcctctagaggtggcacccccagg
gaggtggtggtggagggacccgccgcctccacggagctgcacaacctggcctcccgcaca
gagtacctggtctccgtgttccccatctatgagggcggggttggcgaaggcctgcggggc
ctggtgaccacagcacctctgcctccgccccgggcgctgaccctggccgcagtgacgccc
agaaccgtccacctcacctggcagccctcggccggggccacccactacctggtgcgatgt
tctcctgcttcccccaagggtgaagaggaggagcgagaggtgcaggtcgggcggcccgag
gtgctgctggatggcctggaacctggcagggactatgaggtctcggtgcagagcctgcga
ggccctgagggcagcgaggcccggggcatccgtgccaggacccccaccctggcccccccg
agacacctgggcttctcagacgtgagccacgacgcggcacgagtgttctgggagggtgcc
ccgaggcctgtgcgcctggtcagggtcacctatgtgtccagcgagggtggacactcgggg
cagacagaggctcctgggaacgccacctcggccacgctggggcctctctcttcctccacc
acctacactgtccgtgtcacctgcctctaccctgggggtggctcctctacgctgactggc
cgggtgaccaccaagaaagctcccagcccaagccagctgtccatgacggagctgccaggg
gatgcagtccagctggcgtgggtggccgcagccccgtctggcgtgcttgtctaccagatc
acgtggacgcccctgggagaggggaaggctcacgagatctctgtcccagggaacctcggc
acggccgtcctgcctggcctagggaggcacacagagtacgacgtcaccatcttggcctac
tacagggacggggcccgcagtgaccctgtgtccctccgctataccccctccacggtgagc
aggagcccaccctccaacctggccctggcctcggagacccccgacagcctgcaggtcagc
tggacgcccccgcttggccgcgtgctccattactggctcacctacgcccccgcctctggc
ttgggacccgagaaatccgtctctgtgccaggagccaggagccacgtgacactgcccgac
ctgcaggcagccacgaagtacagggtcctggtctcagctatctatgcagcaggcaggagt
gaggctgtgtctgccacgggccagacagcctgcccagccctccgccctgacggctccctc
ccagggtttgacctgatggtggccttcagcctggtggaaaaggcttatgcgtccatccgg
ggcgtggccatggagccctctgccttcggtgggaccccgaccttcacgctcttcaaggac
gcccagctgacaagacgggtcagtgacgtctacccagcccccctacctccagagcacacc
atcgtcttccttgtgcgcctacttcccgagacaccccgtgaggccttcgcgctgtggcag
atgacagccgaggacttccagcccctccttggggttctgctggatgccgggaagaagtcc
ctgacctacttccaccgtgaccccagggctgccttgcaggaggccaccttcgacccgcag
gaagtgaggaagattttcttcgggagcttccacaaggtgcacgtggctgtgggccgctcc
aaggtcaggctctatgtggactgccggaaggtggctgagcggccccttggggagatgggc
agcccacccgctgcgggcttcgtcacgctggggaggctggccaaggccaggggcccccgg
agcagttcggccgcgtttcagctccagatgctgcagatcgtgtgcagtgacacctgggcc
gatgaggaccggtgctgtgagctccctgcctcgagggatggagagacctgccccgccttc
gtgtctgcctgttcctgttcctcagagacccctgggcccccaggacctcaaggaccccca
ggcctccctgggaggaatggcaccccaggagagcagggcttcccagggcccaggggtcca
ccaggggtcaaaggagagaagggagaccatgggcttccaggcttgcagggccaccccggc
caccagggcatccccgggagagttggcctccagggaccaaagggaatgagaggcctggag
ggaactgctggcctgcctggaccccctggccccagggggttccagggcatggcaggggcc
aggggcactagtggagagcgaggacctccagggaccgtggggcccacaggactgccaggg
cccaaaggggaacgaggagagaagggcgagccgcagtcccttgccaccctctaccagctt
gtgagccaggcctcacacgtgtcaaagttcgactccttccacgagaacaccaggcccccc
atgcccatcttggagcagaagctggagccgggcactgagcccctggggtcccctggcacc
cgcagcaaggccctggttcctggagaatgggggcgtggtggccgccaccttgagggcaga
ggggagcctggagctgttggtcagatgggcagccctgggcagcagggggctagcacccag
ggcctctgggagtga

DBGET integrated database retrieval system