KEGG   Homo sapiens (human): 57654
Entry
57654             CDS       T01001                                 
Symbol
UVSSA, KIAA1530, UVSS3
Name
(RefSeq) UV stimulated scaffold protein A
  KO
K23720  UV-stimulated scaffold protein A
Organism
hsa  Homo sapiens (human)
Disease
H02131  UV-sensitive syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    57654 (UVSSA)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Other TCR factor
      57654 (UVSSA)
SSDB
Motif
Pfam: DUF2043
Other DBs
NCBI-GeneID: 57654
NCBI-ProteinID: NP_001304863
OMIM: 614632
HGNC: 29304
Ensembl: ENSG00000163945
Pharos: Q2YD98(Tbio)
UniProt: Q2YD98 Q69YU2
Structure
Position
4:1342011..1395989
AA seq 709 aa
MDQKLSKLVEELTTSGEPRLNPEKMKELKKICKSSEEQLSRAYRLLIAQLTQEHAEIRLS
AFQIVEELFVRSHQFRMLVVSNFQEFLELTLGTDPAQPLPPPREAAQRLRQATTRAVEGW
NEKFGEAYKKLALGYHFLRHNKKVDFQDTNARSLAERKREEEKQKHLDKIYQERASQAER
EMQEMSGEIESCLTEVESCFRLLVPFDFDPNPETESLGMASGMSDALRSSCAGQVGPCRS
GTPDPRDGEQPCCSRDLPASAGHPRAGGGAQPSQTATGDPSDEDEDSDLEEFVRSHGLGS
HKYTLDVELCSEGLKVQENEDNLALIHAARDTLKLIRNKFLPAVCSWIQRFTRVGTHGGC
LKRAIDLKAELELVLRKYKELDIEPEGGERRRTEALGDAEEDEDDEDFVEVPEKEGYEPH
IPDHLRPEYGLEAAPEKDTVVRCLRTRTRMDEEVSDPTSAAAQLRQLRDHLPPPSSASPS
RALPEPQEAQKLAAERARAPVVPYGVDLHYWGQELPTAGKIVKSDSQHRFWKPSEVEEEV
VNADISEMLRSRHITFAGKFEPVQHWCRAPRPDGRLCERQDRLKCPFHGKIVPRDDEGRP
LDPEDRAREQRRQLQKQERPEWQDPELMRDVEAATGQDLGSSRYSGKGRGKKRRYPSLTN
LKAQADTARARIGRKVFAKAAVRRVVAAMNRMDQKKHEKFSNQFNYALN
NT seq 2130 nt   +upstreamnt  +downstreamnt
atggatcagaaactttcgaagttggtagaagagctcacaacttcaggagaaccccgacta
aatcctgagaaaatgaaggaactgaagaaaatttgcaagtcttcagaggagcagctgagc
cgcgcctaccgcctgctgatagcacagctgacccaggagcacgccgagatccgtctctca
gccttccagattgtggaggaactcttcgtcaggtctcaccagttccggatgctggttgtt
tccaacttccaggagttcctggagctcacgctgggcacagaccccgcacagcctctgccg
ccccccagggaggcggcacagaggctgaggcaggcgaccacccgggccgtggaagggtgg
aatgagaagtttggggaggcctacaagaagcttgccttgggctaccacttcttaagacac
aacaaaaaggtggattttcaagacacgaatgctcggagtctggcagaaaggaagagagaa
gaggagaagcagaagcacttggataaaatttatcaagaaagagccagccaggcggagagg
gagatgcaagaaatgtctggagaaattgaatcctgcttgacggaggtagagagctgcttt
aggctgctggtgccttttgactttgacccgaacccggagacggaatcccttggcatggct
tctggcatgtccgatgcccttcgctcctcctgcgcgggccaggtgggcccctgccggtct
ggcacccctgacccccgggacggggagcagccctgctgcagtagagacctgcctgcctct
gcaggccaccccagagcgggcggcggggcacagccatcccagacagccacaggtgacccc
tcagatgaggacgaggacagcgacctcgaggagtttgtgcggagccacgggctgggctcg
cacaagtacacgctggatgtggagctctgctcagagggcctgaaggtgcaggagaacgag
gacaaccttgctctcatccacgccgcccgcgacacactcaagctcatccggaacaagttc
ctgccggctgtgtgctcgtggatccagcgcttcacccgcgtcgggacccacggtggatgt
ttaaagcgtgccattgacctgaaggctgaattggagctcgtactgagaaaatacaaggag
ctggacatcgagcctgagggaggggaaaggcgcaggacagaagccctgggggatgcggag
gaagatgaggacgatgaggactttgtggaggtccctgagaaggaggggtatgagccacac
atccccgaccacttgcggcctgagtatgggctggaggcagcaccagagaaagacacagtt
gtgcggtgcttgcggacgaggacgaggatggacgaggaggtgtcggaccccacctctgcg
gctgctcagctgcggcagctccgggaccacttgcctccaccctcatctgccagcccctcc
agagcgttgccagagccacaggaggcccagaagctggcagcagagcgggcccgggcgcct
gtggtgccctacggcgtggacctgcactactggggccaggagctccccacagccgggaag
attgtcaagtctgactcccagcaccgcttctggaagcccagcgaggtggaggaggaagtg
gtcaatgccgacatctccgagatgctccggagccgccacatcacttttgccgggaagttt
gagcctgtgcagcactggtgccgtgccccgaggccagacggccggctctgtgagcgccaa
gaccggctgaagtgccctttccatgggaagattgttccacgggacgacgaaggacggccg
ctcgacccggaagacagggctcgtgagcagcggcggcagctgcagaagcaggagcgcccg
gaatggcaggaccctgagttgatgagagacgtggaagcagccacagggcaggatctcggc
tcatccaggtacagcgggaaaggcagggggaagaagaggaggtaccccagcctcaccaac
ctgaaggctcaggctgataccgcccgcgctcgcattgggagaaaagtcttcgccaaggca
gctgtgcggagggtagtggcagccatgaaccggatggaccagaagaagcacgagaagttt
tcaaaccagtttaactacgcactgaactag

DBGET integrated database retrieval system