KEGG   Homo sapiens (human): 57657Help
Entry
57657             CDS       T01001                                 

Gene name
HCN3
Definition
(RefSeq) hyperpolarization activated cyclic nucleotide gated potassium channel 3
  KO
K04956  hyperpolarization activated cyclic nucleotide-gated potassium channel 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04929  GnRH secretion
Drug target
Ivabradine (DG00246): D07165 D08095
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    57657 (HCN3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    57657 (HCN3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (HCN)
   57657 (HCN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ion_trans_N cNMP_binding Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 57657
NCBI-ProteinID: NP_065948
OMIM: 609973
HGNC: 19183
Ensembl: ENSG00000143630
Vega: OTTHUMG00000035872
Pharos: Q9P1Z3(Tclin)
UniProt: Q9P1Z3
Position
1q22
AA seq 774 aa AA seqDB search
MEAEQRPAAGASEGATPGLEAVPPVAPPPATAASGPIPKSGPEPKRRHLGTLLQPTVNKF
SLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFKE
ENSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGAEILLAPRAIRTRYLRTWFLVDLISS
IPVDYIFLVVELEPRLDAEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHM
TYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVSINHMVNHSWGRQYSH
ALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQY
QEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFDEESILGELSEPLREEIINFTCR
GLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLARGA
RDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETVA
MDRLLRIGKKNSILQRKRSEPSPGSSGGIMEQHLVQHDRDMARGVRGRAPSTGAQLSGKP
VLWEPLVHAPLQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSAWRSAGSPASPLVPV
RAGPWASTSRLPAPPARTLHASLSRAGRSQVSLLGPPPGGGGRRLGPRGRPLSASQPSLP
QRATGDGSPGRKGSGSERLPPSGLLAKPPRTAQPPRPPVPEPATPRGLQLSANM
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagagcagcggccggcggcgggggccagcgaaggggcgacccctggactggag
gcggtgcctcccgttgctcccccgcctgcgaccgcggcctcaggtccgatccccaaatct
gggcctgagcctaagaggaggcaccttgggacgctgctccagcctacggtcaacaagttc
tcccttcgggtgttcggcagccacaaagcagtggaaatcgagcaggagcgggtgaagtca
gcgggggcctggatcatccacccctacagcgacttccggttttactgggacctgatcatg
ctgctgctgatggtggggaacctcatcgtcctgcctgtgggcatcaccttcttcaaggag
gagaactccccgccttggatcgtcttcaacgtattgtctgatactttcttcctactggat
ctggtgctcaacttccgaacgggcatcgtggtggaggagggtgctgagatcctgctggca
ccgcgggccatccgcacgcgctacctgcgcacctggttcctggttgacctcatctcttct
atccctgtggattacatcttcctagtggtggagctggagccacggttggacgctgaggtc
tacaaaacggcacgggccctacgcatcgttcgcttcaccaagatcctaagcctgctgagg
ctgctccgcctctcccgcctcatccgctacatacaccagtgggaggagatctttcacatg
acctatgacctggccagtgctgtggttcgcatcttcaacctcattgggatgatgctgctg
ctatgtcactgggatggctgtctgcagttcctggtgcccatgctgcaggacttccctccc
gactgctgggtctccatcaaccacatggtgaaccactcgtggggccgccagtattcccat
gccctgttcaaggccatgagccacatgctgtgcattggctatgggcagcaggcacctgta
ggcatgcccgacgtctggctcaccatgctcagcatgatcgtaggtgccacatgctacgcc
atgttcatcggccatgccacggcactcatccagtccctggactcttcccggcgtcagtac
caggagaagtacaagcaggtggagcagtacatgtccttccacaagctgccagcagacacg
cggcagcgcatccacgagtactatgagcaccgctaccagggcaagatgttcgatgaggaa
agcatcctgggcgagctgagcgagccgcttcgcgaggagatcattaacttcacctgtcgg
ggcctggtggcccacatgccgctgtttgcccatgccgaccccagcttcgtcactgcagtt
ctcaccaagctgcgctttgaggtcttccagccgggggatctcgtggtgcgtgagggctcc
gtggggaggaagatgtacttcatccagcatgggctgctcagtgtgctggcccgcggcgcc
cgggacacacgcctcaccgatggatcctactttggggagatctgcctgctaactaggggc
cggcgcacagccagtgttcgggctgacacctactgccgcctttactcactcagcgtggac
catttcaatgctgtgcttgaggagttccccatgatgcgccgggcctttgagactgtggcc
atggatcggctgctccgcatcggcaagaagaattccatactgcagcggaagcgctccgag
ccaagtccaggcagcagtggtggcatcatggagcagcacttggtgcaacatgacagagac
atggctcggggtgttcggggtcgggccccgagcacaggagctcagcttagtggaaagcca
gtactgtgggagccactggtacatgcgccccttcaggcagctgctgtgacctccaatgtg
gccattgccctgactcatcagcggggccctctgcccctctcccctgactctccagccacc
ctccttgctcgctctgcttggcgctcagcaggctctccagcttccccgctggtgcccgtc
cgagctggcccatgggcatccacctcccgcctgcccgccccacctgcccgaaccctgcac
gccagcctatcccgggcagggcgctcccaggtctccctgctgggtccccctccaggagga
ggtggacggcggctaggacctcggggccgcccactctcagcctcccaaccctctctgcct
cagcgggcaacaggcgatggctctcctgggcgtaagggatcaggaagtgagcggctgcct
ccctcagggctcctggccaaacctccaaggacagcccagccccccaggccaccagtgcct
gagccagccacaccccggggtctccagctttctgccaacatgtaa

DBGET integrated database retrieval system