KEGG   Homo sapiens (human): 57658
Entry
57658             CDS       T01001                                 
Symbol
CALCOCO1, Cocoa, PP13275, calphoglin
Name
(RefSeq) calcium binding and coiled-coil domain 1
  KO
K25828  calcium-binding and coiled-coil domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    57658 (CALCOCO1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    Others
     57658 (CALCOCO1)
SSDB
Motif
Pfam: CALCOCO1 SKICH Zn-C2H2_12 DUF724 Pox_A8 Vps23_core Pox_A_type_inc Crescentin
Other DBs
NCBI-GeneID: 57658
NCBI-ProteinID: NP_065949
HGNC: 29306
Ensembl: ENSG00000012822
Pharos: Q9P1Z2(Tbio)
UniProt: Q9P1Z2 A0A024RAZ1
Position
12:complement(53708517..53727452)
AA seq 691 aa
MEESPLSRAPSRGGVNFLNVARTYIPNTKVECHYTLPPGTMPSASDWIGIFKVEAACVRD
YHTFVWSSVPESTTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFRE
PRPMDELVTLEEADGGSDILLVVPKATVLQNQLDESQQERNDLMQLKLQLEGQVTELRSR
VQELERALATARQEHTELMEQYKGISRSHGEITEERDILSRQQGDHVARILELEDDIQTI
SEKVLTKEVELDRLRDTVKALTREQEKLLGQLKEVQADKEQSEAELQVAQQENHHLNLDL
KEAKSWQEEQSAQAQRLKDKVAQMKDTLGQAQQRVAELEPLKEQLRGAQELAASSQQKAT
LLGEELASAAAARDRTIAELHRSRLEVAEVNGRLAELGLHLKEEKCQWSKERAGLLQSVE
AEKDKILKLSAEILRLEKAVQEERTQNQVFKTELAREKDSSLVQLSESKRELTELRSALR
VLQKEKEQLQEEKQELLEYMRKLEARLEKVADEKWNEDATTEDEEAAVGLSCPAALTDSE
DESPEDMRLPPYGLCERGDPGSSPAGPREASPLVVISQPAPISPHLSGPAEDSSSDSEAE
DEKSVLMAAVQSGGEEANLLLPELGSAFYDMASGFTVGTLSETSTGGPATPTWKECPICK
ERFPAESDKDALEDHMDGHFFFSTQDPFTFE
NT seq 2076 nt   +upstreamnt  +downstreamnt
atggaagaatcaccactaagccgggcaccatcccgtggtggagtcaactttctcaatgta
gcccggacctacatccccaacaccaaggtggaatgtcactacacccttcccccaggcacc
atgcccagtgccagtgactggattggcatcttcaaggtggaggctgcctgtgttcgggat
taccacacatttgtgtggtcttccgtgcctgaaagtacaactgatggttcccccattcac
accagtgtccagttccaagccagctacctgcccaaaccaggagctcagctctaccagttc
cgatatgtgaaccgccagggccaggtgtgtgggcagagcccccctttccagttccgagag
ccaaggcccatggatgaactggtgaccctggaggaggctgatgggggctctgacatcctg
ctggttgtccccaaggcaactgtgttacagaaccagctcgatgagagccagcaagaacgg
aatgacctgatgcagctgaagctacagctggagggacaggtgacagagctgaggagccga
gtgcaggagctcgagagggctctggcaactgccaggcaggagcacacggagctgatggaa
cagtacaaggggatttcccggtcccatggggagatcacagaagagagggacatcctgagc
cggcaacagggagaccatgtggcacgcatcctggagctagaggatgacatccagaccatc
agtgagaaagtgctgacgaaggaagtggagctggacaggcttagagacacagtgaaggcc
ctgactcgggaacaagagaagctccttgggcaactgaaagaagtacaagcagacaaggag
caaagtgaggctgagctccaagtggcacaacaggagaaccatcacttaaatttggacctg
aaggaggcgaagagctggcaagaggagcagagtgctcaggctcagcgactgaaagacaag
gtggcccagatgaaggacaccctaggccaggcccagcagcgggtggccgagctggagccc
ttgaaggagcagcttcgaggggcccaggagcttgcagcctcaagccagcagaaagccacc
cttcttggggaggagttggccagtgcagcagcagccagggaccgcaccatagccgaacta
caccgcagccgcctggaagtggctgaagttaacggcaggctggctgagctcggtttgcac
ttgaaggaagaaaaatgccaatggagcaaggagcgggcagggctgctgcagagtgtggag
gcagagaaggacaagatcctgaagctgagtgcagagatacttcgattggagaaggcagtt
caggaggagaggacccaaaaccaagtgttcaagactgagctggcccgggagaaggattct
agcctggtacagttgtcagaaagtaagcgggagctgacagagctgcggtcagccctgcgt
gtgctccagaaggaaaaggagcagttacaggaggagaaacaggaattgctagagtacatg
agaaagctagaggcccgcctggagaaggtggcagatgagaagtggaatgaggatgccacc
acagaggatgaggaggccgctgtggggctgagctgcccggcagctctgacagactcagag
gacgagtccccagaagacatgaggctcccaccctatggcctttgtgagcgtggagaccca
ggctcctctcctgctgggcctcgagaggcttctccccttgttgtcatcagccagccggct
cccatttctcctcacctctctgggccagctgaggacagtagctctgactcggaggctgaa
gatgagaagtcagtcctgatggcagctgtgcagagtgggggtgaggaggccaacttactg
cttcctgaactgggcagtgccttctatgacatggccagtggctttacagtgggtaccctg
tcagaaaccagcactgggggccctgccacccccacatggaaggagtgtcctatctgtaag
gagcgctttcctgctgagagtgacaaggatgccctggaggaccacatggatggacacttc
tttttcagcacccaggaccccttcacctttgagtga

DBGET integrated database retrieval system