KEGG   Homo sapiens (human): 57658Help
Entry
57658             CDS       T01001                                 

Gene name
CALCOCO1, Cocoa, PP13275, calphoglin
Definition
(RefSeq) calcium binding and coiled-coil domain 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: CALCOCO1 SKICH Zn-C2H2_12 DUF724 Pox_A8 Pox_A_type_inc Vps23_core
Motif
Other DBs
NCBI-GeneID: 57658
NCBI-ProteinID: NP_065949
HGNC: 29306
Ensembl: ENSG00000012822
Vega: OTTHUMG00000170095
Pharos: Q9P1Z2(Tbio)
UniProt: Q9P1Z2 A0A024RAZ1
Position
12q13.13
AA seq 691 aa AA seqDB search
MEESPLSRAPSRGGVNFLNVARTYIPNTKVECHYTLPPGTMPSASDWIGIFKVEAACVRD
YHTFVWSSVPESTTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFRE
PRPMDELVTLEEADGGSDILLVVPKATVLQNQLDESQQERNDLMQLKLQLEGQVTELRSR
VQELERALATARQEHTELMEQYKGISRSHGEITEERDILSRQQGDHVARILELEDDIQTI
SEKVLTKEVELDRLRDTVKALTREQEKLLGQLKEVQADKEQSEAELQVAQQENHHLNLDL
KEAKSWQEEQSAQAQRLKDKVAQMKDTLGQAQQRVAELEPLKEQLRGAQELAASSQQKAT
LLGEELASAAAARDRTIAELHRSRLEVAEVNGRLAELGLHLKEEKCQWSKERAGLLQSVE
AEKDKILKLSAEILRLEKAVQEERTQNQVFKTELAREKDSSLVQLSESKRELTELRSALR
VLQKEKEQLQEEKQELLEYMRKLEARLEKVADEKWNEDATTEDEEAAVGLSCPAALTDSE
DESPEDMRLPPYGLCERGDPGSSPAGPREASPLVVISQPAPISPHLSGPAEDSSSDSEAE
DEKSVLMAAVQSGGEEANLLLPELGSAFYDMASGFTVGTLSETSTGGPATPTWKECPICK
ERFPAESDKDALEDHMDGHFFFSTQDPFTFE
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatcaccactaagccgggcaccatcccgtggtggagtcaactttctcaatgta
gcccggacctacatccccaacaccaaggtggaatgtcactacacccttcccccaggcacc
atgcccagtgccagtgactggattggcatcttcaaggtggaggctgcctgtgttcgggat
taccacacatttgtgtggtcttccgtgcctgaaagtacaactgatggttcccccattcac
accagtgtccagttccaagccagctacctgcccaaaccaggagctcagctctaccagttc
cgatatgtgaaccgccagggccaggtgtgtgggcagagcccccctttccagttccgagag
ccaaggcccatggatgaactggtgaccctggaggaggctgatgggggctctgacatcctg
ctggttgtccccaaggcaactgtgttacagaaccagctcgatgagagccagcaagaacgg
aatgacctgatgcagctgaagctacagctggagggacaggtgacagagctgaggagccga
gtgcaggagctcgagagggctctggcaactgccaggcaggagcacacggagctgatggaa
cagtacaaggggatttcccggtcccatggggagatcacagaagagagggacatcctgagc
cggcaacagggagaccatgtggcacgcatcctggagctagaggatgacatccagaccatc
agtgagaaagtgctgacgaaggaagtggagctggacaggcttagagacacagtgaaggcc
ctgactcgggaacaagagaagctccttgggcaactgaaagaagtacaagcagacaaggag
caaagtgaggctgagctccaagtggcacaacaggagaaccatcacttaaatttggacctg
aaggaggcgaagagctggcaagaggagcagagtgctcaggctcagcgactgaaagacaag
gtggcccagatgaaggacaccctaggccaggcccagcagcgggtggccgagctggagccc
ttgaaggagcagcttcgaggggcccaggagcttgcagcctcaagccagcagaaagccacc
cttcttggggaggagttggccagtgcagcagcagccagggaccgcaccatagccgaacta
caccgcagccgcctggaagtggctgaagttaacggcaggctggctgagctcggtttgcac
ttgaaggaagaaaaatgccaatggagcaaggagcgggcagggctgctgcagagtgtggag
gcagagaaggacaagatcctgaagctgagtgcagagatacttcgattggagaaggcagtt
caggaggagaggacccaaaaccaagtgttcaagactgagctggcccgggagaaggattct
agcctggtacagttgtcagaaagtaagcgggagctgacagagctgcggtcagccctgcgt
gtgctccagaaggaaaaggagcagttacaggaggagaaacaggaattgctagagtacatg
agaaagctagaggcccgcctggagaaggtggcagatgagaagtggaatgaggatgccacc
acagaggatgaggaggccgctgtggggctgagctgcccggcagctctgacagactcagag
gacgagtccccagaagacatgaggctcccaccctatggcctttgtgagcgtggagaccca
ggctcctctcctgctgggcctcgagaggcttctccccttgttgtcatcagccagccggct
cccatttctcctcacctctctgggccagctgaggacagtagctctgactcggaggctgaa
gatgagaagtcagtcctgatggcagctgtgcagagtgggggtgaggaggccaacttactg
cttcctgaactgggcagtgccttctatgacatggccagtggctttacagtgggtaccctg
tcagaaaccagcactgggggccctgccacccccacatggaaggagtgtcctatctgtaag
gagcgctttcctgctgagagtgacaaggatgccctggaggaccacatggatggacacttc
tttttcagcacccaggaccccttcacctttgagtga

DBGET integrated database retrieval system